Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	113675
Gene name	Serine dehydratase like
Gene symbol	SDSL
Synonyms (NCBI Gene)	SDH 2SDHLSDS-RS1TDHcSDH
Chromosome	12
Chromosome location	12q24.13

31 Show/Hide all (31)

miRTarBase ID	miRNA	Experiments
MIRT2098160	hsa-miR-1827	CLIP-seq
MIRT2098161	hsa-miR-205	CLIP-seq
MIRT2098162	hsa-miR-3612	CLIP-seq
MIRT2098163	hsa-miR-4433	CLIP-seq
MIRT2098164	hsa-miR-4459	CLIP-seq
MIRT2098165	hsa-miR-4695-5p	CLIP-seq
MIRT2098166	hsa-miR-4768-3p	CLIP-seq
MIRT2098167	hsa-miR-650	CLIP-seq
MIRT2322893	hsa-miR-1202	CLIP-seq
MIRT2098160	hsa-miR-1827	CLIP-seq
MIRT2098161	hsa-miR-205	CLIP-seq
MIRT2322894	hsa-miR-2115	CLIP-seq
MIRT2322895	hsa-miR-3158-3p	CLIP-seq
MIRT2322896	hsa-miR-3194-5p	CLIP-seq
MIRT2098162	hsa-miR-3612	CLIP-seq
MIRT2322897	hsa-miR-3972	CLIP-seq
MIRT2322898	hsa-miR-4274	CLIP-seq
MIRT2098163	hsa-miR-4433	CLIP-seq
MIRT2322899	hsa-miR-4436b-3p	CLIP-seq
MIRT2322900	hsa-miR-4436b-5p	CLIP-seq
MIRT2098164	hsa-miR-4459	CLIP-seq
MIRT2322901	hsa-miR-455-3p	CLIP-seq
MIRT2098165	hsa-miR-4695-5p	CLIP-seq
MIRT2322902	hsa-miR-4721	CLIP-seq
MIRT2322903	hsa-miR-4727-5p	CLIP-seq
MIRT2098166	hsa-miR-4768-3p	CLIP-seq
MIRT2322904	hsa-miR-4769-3p	CLIP-seq
MIRT2322905	hsa-miR-4779	CLIP-seq
MIRT2322906	hsa-miR-516a-3p	CLIP-seq
MIRT2098167	hsa-miR-650	CLIP-seq
MIRT2322907	hsa-miR-665	CLIP-seq

15 Show/Hide all (15)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003941	Function	L-serine ammonia-lyase activity	IBA
GO:0003941	Function	L-serine ammonia-lyase activity	IDA	16580895
GO:0003941	Function	L-serine ammonia-lyase activity	IEA
GO:0004794	Function	Threonine deaminase activity	IDA	16580895
GO:0004794	Function	Threonine deaminase activity	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006520	Process	Amino acid metabolic process	IEA
GO:0006565	Process	L-serine catabolic process	IBA
GO:0006629	Process	Lipid metabolic process	IEA
GO:0008881	Function	Glutamate racemase activity	IEA
GO:0008881	Function	Glutamate racemase activity	ISS
GO:0016829	Function	Lyase activity	IEA
GO:0016853	Function	Isomerase activity	IEA
GO:0030170	Function	Pyridoxal phosphate binding	IEA
GO:0042802	Function	Identical protein binding	IPI	16189514, 25416956, 31515488, 32296183

MIM	HGNC	e!Ensembl
620735	30404	ENSG00000139410

Q96GA7

Protein name

Serine dehydratase-like (Cancerous serine dehydratase) (cSDH) (Glutamate racemase) (EC 5.1.1.3) (L-serine deaminase) (EC 4.3.1.17) (L-serine dehydratase/L-threonine deaminase) (SDHL) (L-threonine dehydratase) (TDH) (EC 4.3.1.19) (Serine dehydratase 2) (SD

Protein function

Catalyzes the pyridoxal-phosphate-dependent dehydrative deamination of L-threonine and L-serine to ammonia and alpha-ketobutyrate and pyruvate, respectively (PubMed:16580895, PubMed:18342636). Also exhibits racemase activity towards L-glutamate

PDB

2RKB

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00291	PALP	12 → 310	Pyridoxal-phosphate dependent enzyme	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in lung cancer cell lines. {ECO:0000269|PubMed:16580895}.

Sequence

MDGPVAEHAKQEPFHVVTPLLESWALSQVAGMPVFLKCENVQPSGSFKIRGIGHFCQEMA
KKGCRHLVCSSGGNAGIAAAYAARKLGIPATIVLPESTSLQVVQRLQGEGAEVQLTGKVW
DEANLRAQELAKRDGWENVPPFDHPLIWKGHASLVQELKAVLRTPPGALVLAVGGGGLLA
GVVAGLLEVGWQHVPIIAMETHGAHCFNAAITAGKLVTLPDITSVAKSLGAKTVAARALE
CMQVCKIHSEVVEDTEAVSAVQQLLDDERMLVEPACGAALAAIYSGLLRRLQAEGCLPPS
LTSVVVIVCGGNNINSRELQALKTHLGQV

Sequence length

329

Interactions

View interactions

KEGG Pathway	Reactome Pathway
Glycine, serine and threonine metabolism	Threonine catabolism
Cysteine and methionine metabolism
Valine, leucine and isoleucine biosynthesis
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Hepatocellular carcinoma	Uncertain significance	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Colon Carcinoma	Colon Carcinoma	BEFREE	16061205		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial aneurysm	Pubtator	39206894	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	16061205		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	37410216	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

SDSL (serine dehydratase like)

Bookmark This Gene