SDK1 (sidekick cell adhesion molecule 1)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 221935
• Gene name: Sidekick cell adhesion molecule 1
• Gene symbol: SDK1
• Synonyms (NCBI Gene): -
• Chromosome: 7
• Chromosome location: 7p22.2
• Summary: The protein encoded by this gene is a member of the immunoglobulin superfamily. The protein contains six immunoglobulin-like domains and thirteen fibronectin type III domains. Fibronectin type III domains are present in both extracellular and intracellula

miRNA Show/Hide all (145)

miRTarBase ID	miRNA	Experiments	Reference
MIRT040164	hsa-miR-615-3p	CLASH	23622248
MIRT492410	hsa-miR-3173-3p	PAR-CLIP	23592263
MIRT492408	hsa-miR-6891-5p	PAR-CLIP	23592263
MIRT492409	hsa-miR-6783-5p	PAR-CLIP	23592263
MIRT492407	hsa-miR-6892-3p	PAR-CLIP	23592263
MIRT492406	hsa-miR-6784-5p	PAR-CLIP	23592263
MIRT492405	hsa-miR-4533	PAR-CLIP	23592263
MIRT492404	hsa-miR-4747-5p	PAR-CLIP	23592263
MIRT492403	hsa-miR-5196-5p	PAR-CLIP	23592263
MIRT492402	hsa-miR-6877-5p	PAR-CLIP	23592263
MIRT492400	hsa-miR-4271	PAR-CLIP	23592263
MIRT492401	hsa-miR-4725-3p	PAR-CLIP	23592263
MIRT492399	hsa-miR-6780b-5p	PAR-CLIP	23592263
MIRT492398	hsa-miR-128-1-5p	PAR-CLIP	23592263
MIRT492397	hsa-miR-128-2-5p	PAR-CLIP	23592263
MIRT492396	hsa-miR-6758-5p	PAR-CLIP	23592263
MIRT453852	hsa-miR-4476	PAR-CLIP	23592263
MIRT453851	hsa-miR-6876-5p	PAR-CLIP	23592263
MIRT453850	hsa-miR-4716-3p	PAR-CLIP	23592263
MIRT453849	hsa-miR-6794-5p	PAR-CLIP	23592263
MIRT453848	hsa-miR-125a-3p	PAR-CLIP	23592263
MIRT453847	hsa-miR-764	PAR-CLIP	23592263
MIRT453846	hsa-miR-3934-5p	PAR-CLIP	23592263
MIRT453845	hsa-miR-1252-5p	PAR-CLIP	23592263
MIRT453844	hsa-miR-3179	PAR-CLIP	23592263
MIRT453843	hsa-miR-1253	PAR-CLIP	23592263
MIRT453842	hsa-miR-6770-5p	PAR-CLIP	23592263
MIRT453841	hsa-miR-3202	PAR-CLIP	23592263
MIRT453840	hsa-miR-3153	PAR-CLIP	23592263
MIRT453839	hsa-miR-6733-5p	PAR-CLIP	23592263
MIRT453838	hsa-miR-6739-5p	PAR-CLIP	23592263
MIRT453837	hsa-miR-625-5p	PAR-CLIP	23592263
MIRT492410	hsa-miR-3173-3p	PAR-CLIP	23592263
MIRT492408	hsa-miR-6891-5p	PAR-CLIP	23592263
MIRT492409	hsa-miR-6783-5p	PAR-CLIP	23592263
MIRT492407	hsa-miR-6892-3p	PAR-CLIP	23592263
MIRT492406	hsa-miR-6784-5p	PAR-CLIP	23592263
MIRT492405	hsa-miR-4533	PAR-CLIP	23592263
MIRT492404	hsa-miR-4747-5p	PAR-CLIP	23592263
MIRT492403	hsa-miR-5196-5p	PAR-CLIP	23592263
MIRT492402	hsa-miR-6877-5p	PAR-CLIP	23592263
MIRT492400	hsa-miR-4271	PAR-CLIP	23592263
MIRT492401	hsa-miR-4725-3p	PAR-CLIP	23592263
MIRT492399	hsa-miR-6780b-5p	PAR-CLIP	23592263
MIRT492398	hsa-miR-128-1-5p	PAR-CLIP	23592263
MIRT492397	hsa-miR-128-2-5p	PAR-CLIP	23592263
MIRT492396	hsa-miR-6758-5p	PAR-CLIP	23592263
MIRT453852	hsa-miR-4476	PAR-CLIP	23592263
MIRT453851	hsa-miR-6876-5p	PAR-CLIP	23592263
MIRT453850	hsa-miR-4716-3p	PAR-CLIP	23592263
MIRT453849	hsa-miR-6794-5p	PAR-CLIP	23592263
MIRT453848	hsa-miR-125a-3p	PAR-CLIP	23592263
MIRT453847	hsa-miR-764	PAR-CLIP	23592263
MIRT453846	hsa-miR-3934-5p	PAR-CLIP	23592263
MIRT453845	hsa-miR-1252-5p	PAR-CLIP	23592263
MIRT453844	hsa-miR-3179	PAR-CLIP	23592263
MIRT453843	hsa-miR-1253	PAR-CLIP	23592263
MIRT453842	hsa-miR-6770-5p	PAR-CLIP	23592263
MIRT453841	hsa-miR-3202	PAR-CLIP	23592263
MIRT453840	hsa-miR-3153	PAR-CLIP	23592263
MIRT453839	hsa-miR-6733-5p	PAR-CLIP	23592263
MIRT453838	hsa-miR-6739-5p	PAR-CLIP	23592263
MIRT453837	hsa-miR-625-5p	PAR-CLIP	23592263
MIRT1331918	hsa-miR-1228	CLIP-seq
MIRT1331919	hsa-miR-1303	CLIP-seq
MIRT1331920	hsa-miR-1324	CLIP-seq
MIRT1331921	hsa-miR-2115	CLIP-seq
MIRT1331922	hsa-miR-2355-3p	CLIP-seq
MIRT1331923	hsa-miR-3124-3p	CLIP-seq
MIRT1331924	hsa-miR-3140-3p	CLIP-seq
MIRT1331925	hsa-miR-3162-3p	CLIP-seq
MIRT1331926	hsa-miR-361-5p	CLIP-seq
MIRT1331927	hsa-miR-3657	CLIP-seq
MIRT1331928	hsa-miR-4428	CLIP-seq
MIRT1331929	hsa-miR-4514	CLIP-seq
MIRT1331930	hsa-miR-4640-5p	CLIP-seq
MIRT1331931	hsa-miR-4646-3p	CLIP-seq
MIRT1331932	hsa-miR-4663	CLIP-seq
MIRT1331933	hsa-miR-4692	CLIP-seq
MIRT1331934	hsa-miR-4726-5p	CLIP-seq
MIRT1331935	hsa-miR-625	CLIP-seq
MIRT1331936	hsa-miR-767-3p	CLIP-seq
MIRT2098083	hsa-miR-1293	CLIP-seq
MIRT2098084	hsa-miR-1343	CLIP-seq
MIRT2098085	hsa-miR-146a	CLIP-seq
MIRT2098086	hsa-miR-146b-5p	CLIP-seq
MIRT2098087	hsa-miR-298	CLIP-seq
MIRT2098088	hsa-miR-3120-3p	CLIP-seq
MIRT2098089	hsa-miR-3150a-3p	CLIP-seq
MIRT2098090	hsa-miR-3157-5p	CLIP-seq
MIRT2098091	hsa-miR-3175	CLIP-seq
MIRT2098092	hsa-miR-326	CLIP-seq
MIRT2098093	hsa-miR-330-5p	CLIP-seq
MIRT2098094	hsa-miR-3942-3p	CLIP-seq
MIRT2098095	hsa-miR-4254	CLIP-seq
MIRT2098096	hsa-miR-4418	CLIP-seq
MIRT2098097	hsa-miR-4483	CLIP-seq
MIRT2098098	hsa-miR-4530	CLIP-seq
MIRT2098099	hsa-miR-503	CLIP-seq
MIRT2098100	hsa-miR-509-3-5p	CLIP-seq
MIRT2098101	hsa-miR-509-5p	CLIP-seq
MIRT2098102	hsa-miR-545	CLIP-seq
MIRT2098103	hsa-miR-589	CLIP-seq
MIRT2098104	hsa-miR-619	CLIP-seq
MIRT2098105	hsa-miR-642b	CLIP-seq
MIRT2098106	hsa-miR-922	CLIP-seq
MIRT2098107	hsa-miR-939	CLIP-seq
MIRT2322808	hsa-miR-124	CLIP-seq
MIRT2098084	hsa-miR-1343	CLIP-seq
MIRT2322809	hsa-miR-15a	CLIP-seq
MIRT2322810	hsa-miR-15b	CLIP-seq
MIRT2322811	hsa-miR-16	CLIP-seq
MIRT2322812	hsa-miR-1909	CLIP-seq
MIRT2322813	hsa-miR-195	CLIP-seq
MIRT2322814	hsa-miR-1976	CLIP-seq
MIRT2098088	hsa-miR-3120-3p	CLIP-seq
MIRT2098094	hsa-miR-3942-3p	CLIP-seq
MIRT2322815	hsa-miR-424	CLIP-seq
MIRT2098095	hsa-miR-4254	CLIP-seq
MIRT2322816	hsa-miR-4419a	CLIP-seq
MIRT2322817	hsa-miR-4459	CLIP-seq
MIRT2322818	hsa-miR-4469	CLIP-seq
MIRT2322819	hsa-miR-4510	CLIP-seq
MIRT2098098	hsa-miR-4530	CLIP-seq
MIRT2322820	hsa-miR-455-3p	CLIP-seq
MIRT2322821	hsa-miR-4779	CLIP-seq
MIRT2322822	hsa-miR-486-3p	CLIP-seq
MIRT2322823	hsa-miR-497	CLIP-seq
MIRT2322824	hsa-miR-506	CLIP-seq
MIRT2322825	hsa-miR-544	CLIP-seq
MIRT2098102	hsa-miR-545	CLIP-seq
MIRT2322826	hsa-miR-548an	CLIP-seq
MIRT2098104	hsa-miR-619	CLIP-seq
MIRT2322827	hsa-miR-642a	CLIP-seq
MIRT2322828	hsa-miR-665	CLIP-seq
MIRT1331922	hsa-miR-2355-3p	CLIP-seq
MIRT2394138	hsa-miR-3909	CLIP-seq
MIRT2322816	hsa-miR-4419a	CLIP-seq
MIRT2322819	hsa-miR-4510	CLIP-seq
MIRT1331931	hsa-miR-4646-3p	CLIP-seq
MIRT2394139	hsa-miR-548aa	CLIP-seq
MIRT2394140	hsa-miR-676	CLIP-seq
MIRT1331918	hsa-miR-1228	CLIP-seq
MIRT2466014	hsa-miR-324-5p	CLIP-seq
MIRT1331932	hsa-miR-4663	CLIP-seq

Gene ontology (GO) Show/Hide all (15)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0007155	Process	Cell adhesion	IEA
GO:0007156	Process	Homophilic cell adhesion via plasma membrane adhesion molecules	IBA
GO:0007156	Process	Homophilic cell adhesion via plasma membrane adhesion molecules	ISS
GO:0007416	Process	Synapse assembly	IBA
GO:0007416	Process	Synapse assembly	ISS
GO:0010842	Process	Retina layer formation	ISS
GO:0016020	Component	Membrane	IEA
GO:0042802	Function	Identical protein binding	ISS
GO:0045202	Component	Synapse	IBA
GO:0045202	Component	Synapse	IEA
GO:0045202	Component	Synapse	ISS
GO:0048148	Process	Behavioral response to cocaine	IEA
GO:0060998	Process	Regulation of dendritic spine development	IEA

Other IDs

• MIM: 607216
• HGNC: 19307
• e!Ensembl: ENSG00000146555

Protein

• UniProt ID: Q7Z5N4
• Protein name: Protein sidekick-1
• Protein function: Adhesion molecule that promotes lamina-specific synaptic connections in the retina. Expressed in specific subsets of interneurons and retinal ganglion cells (RGCs) and promotes synaptic connectivity via homophilic interactions. {ECO:0000250|UniP
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00041	fn3	1703 → 1790	Fibronectin type III domain	Domain
  PF00041	fn3	669 → 755	Fibronectin type III domain	Domain
  PF00041	fn3	973 → 1057	Fibronectin type III domain	Domain
  PF00041	fn3	770 → 857	Fibronectin type III domain	Domain
  PF00041	fn3	1904 → 1990	Fibronectin type III domain	Domain
  PF00041	fn3	1175 → 1264	Fibronectin type III domain	Domain
  PF00041	fn3	1278 → 1365	Fibronectin type III domain	Domain
  PF00041	fn3	1379 → 1463	Fibronectin type III domain	Domain
  PF00041	fn3	1803 → 1889	Fibronectin type III domain	Domain
  PF00041	fn3	1580 → 1689	Fibronectin type III domain	Domain
  PF00041	fn3	1478 → 1565	Fibronectin type III domain	Domain
  PF00041	fn3	871 → 960	Fibronectin type III domain	Domain
  PF00041	fn3	1071 → 1160	Fibronectin type III domain	Domain
  PF07679	I-set	480 → 570	Immunoglobulin I-set domain	Domain
  PF07679	I-set	386 → 475	Immunoglobulin I-set domain	Domain
  PF07679	I-set	192 → 278	Immunoglobulin I-set domain	Domain
  PF13927	Ig_3	292 → 365		Domain
  PF13927	Ig_3	575 → 650		Domain
  PF13927	Ig_3	104 → 173		Domain

• Tissue specificity: TISSUE SPECIFICITY: Up-regulated in glomeruli in HIV-associated nephropathy. In diseased glomeruli, significantly overexpressed and the expression is no longer restricted to mesangial cells but includes podocytes and parietal epithelial cells (PubMed:1521
• Sequence:

  MARGARPSAAGGGGGGAEPPERAGPGRPRGSPPGRARPSLAPRPGPEPSRPRAAPETSGG
  DTAGAGRCGGRRAAKLGPGRRGWWALLALQLHLLRALAQDDVAPYFKTEPGLPQIHLEGN
  RLVLTCLAEGSWPLEFKWMRDDSELTTYSSEYKYIIPSLQKLDAGFYRCVVRNRMGALLQ
  RKSEVQVAYMGSFMDTDQRKTVSQGRAAILNLLPITSYPRPQVTWFREGHKIIPSNRIAI
  TLENQLVILATTTSDAGAYYVQAVNEKNGENKTSPFIHLSIARDVGTPETMAPTIVVPPG
  NRSVVAGSSETTLECIASARPVEDLSVTWKRNGVRITSGLHSFGRRLTISNPTSADTGPY
  VCEAALPGSAFEPARATAFLFIIEPPYFTAEPESRISAEVEETVDIGCQAMGVPLPTLQW
  YKDAISISRLQNPRYKVLASGGLRIQKLRPEDSGIFQCFASNEGGEIQTHTYLDVTNIAP
  VFTQRPVDTTVTDGMTAILRCEVSGAPKPAITWKRENHILASGSVRIPRFMLLESGGLQI
  APVFIQDAGNYTCYAANTEGSLNASATLTVWNRTSIVHPPEDHVVIKGTTATLHCGATHD
  PRVSLRYVWKKDNVALTPSSTSRIVVEKDGSLLISQTWSGDIGDYSCEIVSEGGNDSRMA
  RLEVIELPHSPQNLLVSPNSSHSHAVVLSWVRPFDGNSPILYYIVELSENNSPWKVHLSN
  VGPEMTGVTVSGLTPARTYQFRVCAVNEVGRGQYSAETSRLMLPEEPPSAPPKNIVASGR
  TNQSIMVQWQPPPETEHNGVLRGYILRYRLAGLPGEYQQRNITSPEVNYCLVTDLIIWTQ
  YEIQVAAYNGAGLGVFSRAVTEYTLQGVPTAPPQNVQTEAVNSTTIQFLWNPPPQQFING
  INQGYKLLAWPADAPEAVTVVTIAPDFHGVHHGHITNLKKFTAYFTSVLCFTTPGDGPPS
  TPQLVWTQEDKPGAVGHLSFTEILDTSLKVSWQEPLEKNGIITGYQISWEVYGRNDSRLT
  HTLNSTTHEYKIQGLSSLTTYTIDVAAVTAVGTGLVTSSTISSGVPPDLPGAPSNLVISN
  ISPRSATLQFRPGYDGKTSISRWIVEGQVGAIGDEEEWVTLYEEENEPDAQMLEIPNLTP
  YTHYRFRMKQVNIVGPSPYSPSSRVIQTLQAPPDVAPTSVTVRTASETSLRLRWVPLPDS
  QYNGNPESVGYRIKYWRSDLQSSAVAQVVSDRLEREFTIEELEEWMEYELQMQAFNAVGA
  GPWSEVVRGRTRESVPSAAPENVSAEAVSSTQILLTWTSVPEQDQNGLILGYKILFRAKD
  LDPEPRSHIVRGNHTQSALLAGLRKFVLYELQVLAFTRIGNGVPSTPLILERTKDDAPGP
  PVRLVFPEVRLTSVRIVWQPPEEPNGIILGYQIAYRLASSSPHTFTTVEVGATVRQFTAT
  DLAPESAYIFRLSAKTRQGWGEPLEATVITTEKRERPAPPRELLVPQAEVTARSLRLQWV
  PGSDGASPIRYFTMQVRELPRGEWQTYSSSISHEATACVVDRLRPFTSYKLRLKATNDIG
  DSDFSSETEAVTTLQDVPGEPPGSVSATPHTTSSVLIQWQPPRDESLNGLLQGYRIYYRE
  LEYEAGSGTEAKTLKNPIALHAELTAQSSFKTVNSSSTSTMCELTHLKKYRRYEVIMTAY
  NIIGESPASAPVEVFVGEAAPAMAPQNVQVTPLTASQLEVTWDPPPPESQNGNIQGYKIY
  YWEADSQNETEKMKVLFLPEPVVRLKNLTSHTKYLVSISAFNAAGDGPKSDPQQGRTHQA
  APGAPSFLAFSEITSTTLNVSWGEPAAANGILQGYRVVYEPLAPVQGVSKVVTVEVRGNW
  QRWLKVRDLTKGVTYFFRVQARTITYGPELQANITAGPAEGSPGSPRDVLVTKSASELTL
  QWTEGHSGDTPTTGYVIEARPSDEGLWDMFVKDIPRSATSYTLSLDKLRQGVTYEFRVVA
  VNEAGYGEPSNPSTAVSAQVEAPFYEEWWFLLVMALSSLIVILLVVFALVLHGQNKKYKN
  CSTGKGISTMEESVTLDNGGFAALELSSRHLNVKSTFSKKNGTRSPPRPSPGGLHYSDED
  ICNKYNGAVLTESVSLKEKSADASESEATDSDYEDALPKHSFVNHYMSDPTYYNSWKRRA
  QGRAPAPHRYEAVAGSEAGAQLHPVITTQSAGGVYTPAGPGARTPLTGFSSFV

• Sequence length: 2213

Pathways

Reactome Pathway:

SDK interactions

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations Show/Hide Unknown Diseases (35)
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	35589863, 35770850, 35851147, 40708016	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANXIETY DISORDER	—	GWAS catalog	31116379	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	GWAS catalog	40155373	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTROCYTOMA	—	GWAS catalog	36810956	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	34446935	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autism spectrum disorder	association	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDERS	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	36810956	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	37359372	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	30801121	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA	—	GWAS catalog	40708016	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DUPUYTREN CONTRACTURE	—	GWAS catalog	37315093, 38172110	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EXOSTOSIS	—	GWAS catalog	39024449	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTROESOPHAGEAL REFLUX DISEASE	—	GWAS catalog	31527586, 35851147, 40155373	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	36810956	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	30804565, 35835914	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LATE-ONSET ALZHEIMER'S DISEASE	—	GWAS catalog	38958117	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Likely benign; Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	30643256, 33859377, 37464041	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROTIC DISORDER	—	GWAS catalog	30643256	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	23251661	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OLIGODENDROGLIOMA	—	GWAS catalog	36810956	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POST-TRAUMATIC STRESS DISORDER	—	GWAS catalog	38637617	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostate cancer	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	35235886, 35396580	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STOMACH DISEASE	—	GWAS catalog	39024449	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SUBSTANCE ABUSE	—	GWAS catalog	34446935	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VISION DISORDER	—	GWAS catalog	33941792	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (21)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adrenocortical Carcinoma	Adrenocortical carcinoma	Pubtator	25490274	Associate	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	36928034	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anxiety Disorders	Anxiety Disorder	GWASCAT_DG	31116379		★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	32807774	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	GWASDB_DG	22935194		★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	Pubtator	24204716	Associate	★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar disorder	Pubtator	34341362	Associate	★☆☆☆☆ Found in Text Mining only
Cap Myopathy	Cap myopathy	Pubtator	23576568	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	25490274	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	28514750	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	34895303	Associate	★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	30867049	Associate	★☆☆☆☆ Found in Text Mining only
Depressive Disorder Major	Major depressive disorder	Pubtator	36928034	Associate	★☆☆☆☆ Found in Text Mining only
Focal glomerulosclerosis	Glomerulosclerosis	BEFREE	20562105		★☆☆☆☆ Found in Text Mining only
Gastroesophageal reflux disease	Gastroesophageal Reflux Disease	GWASCAT_DG	31527586		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	BEFREE	19851296		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	28514750		★☆☆☆☆ Found in Text Mining only
Marfan Syndrome	Marfan syndrome	Pubtator	34895303	Associate	★☆☆☆☆ Found in Text Mining only
Motion Sickness	Motion Sickness	GWASCAT_DG	25628336		★☆☆☆☆ Found in Text Mining only
Narcolepsy	Narcolepsy	GWASDB_DG	19629137		★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	GWASDB_DG	23000144		★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

EIF3E 2 shared diseasesDupuytren contracture, Gastroesophageal reflux disease 2 shared evidence sourcesGWAS catalog (Dupuytren contracture), GWAS catalog (Gastroesophageal reflux disease) Related via 2 shared diseases including Dupuytren contracture, Gastroesophageal reflux disease — evidence mostly GWAS catalog. PCDHA3 2 shared diseasesGastroesophageal reflux disease, Post-traumatic stress disorder 2 shared evidence sourcesGWAS catalog (Gastroesophageal reflux disease), GWAS catalog (Post-traumatic stress disorder) Related via 2 shared diseases including Gastroesophageal reflux disease, Post-traumatic stress disorder — evidence mostly GWAS catalog. PCDHA4 2 shared diseasesGastroesophageal reflux disease, Post-traumatic stress disorder 2 shared evidence sourcesGWAS catalog (Gastroesophageal reflux disease), GWAS catalog (Post-traumatic stress disorder) Related via 2 shared diseases including Gastroesophageal reflux disease, Post-traumatic stress disorder — evidence mostly GWAS catalog. SNRK 2 shared diseasesGastroesophageal reflux disease, Post-traumatic stress disorder 2 shared evidence sourcesGWAS catalog (Gastroesophageal reflux disease), GWAS catalog (Post-traumatic stress disorder) Related via 2 shared diseases including Gastroesophageal reflux disease, Post-traumatic stress disorder — evidence mostly GWAS catalog. PTPRT 2 shared diseasesAnxiety disorder, Gastroesophageal reflux disease 2 shared evidence sourcesGWAS catalog (Anxiety disorder), GWAS catalog (Gastroesophageal reflux disease) Related via 2 shared diseases including Anxiety disorder, Gastroesophageal reflux disease — evidence mostly GWAS catalog.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
EIF3E	2	["Dupuytren contracture","Gastroesophageal reflux disease"]	0	[]	2	["GWAS catalog (Dupuytren contracture)","GWAS catalog (Gastroesophageal reflux disease)"]
PCDHA3	2	["Gastroesophageal reflux disease","Post-traumatic stress disorder"]	0	[]	2	["GWAS catalog (Gastroesophageal reflux disease)","GWAS catalog (Post-traumatic stress disorder)"]
PCDHA4	2	["Gastroesophageal reflux disease","Post-traumatic stress disorder"]	0	[]	2	["GWAS catalog (Gastroesophageal reflux disease)","GWAS catalog (Post-traumatic stress disorder)"]
SNRK	2	["Gastroesophageal reflux disease","Post-traumatic stress disorder"]	0	[]	2	["GWAS catalog (Gastroesophageal reflux disease)","GWAS catalog (Post-traumatic stress disorder)"]
PTPRT	2	["Anxiety disorder","Gastroesophageal reflux disease"]	0	[]	2	["GWAS catalog (Anxiety disorder)","GWAS catalog (Gastroesophageal reflux disease)"]

Diseases Linked via Similar Genes

Androgenetic alopecia Linked via 1 of 5 related genesEIF3E Obstructive pulmonary disease Linked via 1 of 5 related genesEIF3E Inflammatory bowel disease Linked via 1 of 5 related genesEIF3E Prostate cancer Linked via 1 of 5 related genesEIF3E Bipolar disorder Linked via 1 of 5 related genesSNRK

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Androgenetic alopecia	1	["EIF3E"]
Obstructive pulmonary disease	1	["EIF3E"]
Inflammatory bowel disease	1	["EIF3E"]
Prostate cancer	1	["EIF3E"]
Bipolar disorder	1	["SNRK"]