SDIM1 (stress responsive DNAJB4 interacting membrane protein 1)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 100505705
Gene name Stress responsive DNAJB4 interacting membrane protein 1
Gene symbol SDIM1
Synonyms (NCBI Gene)
-
Chromosome 6
Chromosome location 6q27
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
4
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 21255413
GO:0006457 Process Protein folding IPI 21255413
GO:0016020 Component Membrane IEA
GO:0042803 Function Protein homodimerization activity IDA 21255413
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC 38749 N/A
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q6ZPB5
Protein name Stress-responsive DNAJB4-interacting membrane protein 1
Protein function Promotes neuronal cells survival to stress conditions.
Family and domains
Tissue specificity TISSUE SPECIFICITY: Expressed in brain with higher detection in neurons than astrocytes. Decreased expression in Alzheimer brains. Detected at protein level in brain and cervix. {ECO:0000269|PubMed:21255413}.
Sequence 
MWPAPCSVGRLLIFFMCSSSGYVVQGCGPSPGARTTLGSPLSLWSIKTPSHIFCTRRAIN
LGFPSPPLVQLIFWSLNAGLDLYLCLISSCGFSQVFWPVEAFCSFSLSFFALALSHKFVI
CRLDQHIFSGFTKSLKNLPPCHRTDI
Sequence length 146
Interactions View interactions

No strongly related genes found yet for SDIM1.

No additional diseases found yet through genes similar to SDIM1.