Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Other IDs Associated diseases
Entrez ID	6383
Gene name	Syndecan 2
Gene symbol	SDC2
Synonyms (NCBI Gene)	CD362HSPGHSPG1SYND2
Chromosome	8
Chromosome location	8q22.1
Summary	The protein encoded by this gene is a transmembrane (type I) heparan sulfate proteoglycan and is a member of the syndecan proteoglycan family. The syndecans mediate cell binding, cell signaling, and cytoskeletal organization and syndecan receptors are req

205

Show/Hide all (205)

miRTarBase ID	miRNA	Experiments	Reference
MIRT468760	hsa-miR-495-3p	PAR-CLIP	23592263
MIRT468759	hsa-miR-5688	PAR-CLIP	23592263
MIRT468758	hsa-miR-7-1-3p	PAR-CLIP	23592263
MIRT468757	hsa-miR-7-2-3p	PAR-CLIP	23592263
MIRT468756	hsa-miR-3125	PAR-CLIP	23592263
MIRT468755	hsa-miR-3916	PAR-CLIP	23592263
MIRT468754	hsa-miR-6859-5p	PAR-CLIP	23592263
MIRT468753	hsa-miR-577	PAR-CLIP	23592263
MIRT468752	hsa-miR-4476	PAR-CLIP	23592263
MIRT468751	hsa-miR-6876-5p	PAR-CLIP	23592263
MIRT468750	hsa-miR-4436b-3p	PAR-CLIP	23592263
MIRT468749	hsa-miR-4632-5p	PAR-CLIP	23592263
MIRT468748	hsa-miR-6735-5p	PAR-CLIP	23592263
MIRT468747	hsa-miR-6879-5p	PAR-CLIP	23592263
MIRT468746	hsa-miR-7843-5p	PAR-CLIP	23592263
MIRT468745	hsa-miR-6847-5p	PAR-CLIP	23592263
MIRT468744	hsa-miR-3179	PAR-CLIP	23592263
MIRT468743	hsa-miR-3150b-3p	PAR-CLIP	23592263
MIRT468742	hsa-miR-4784	PAR-CLIP	23592263
MIRT468741	hsa-miR-3616-3p	PAR-CLIP	23592263
MIRT468740	hsa-miR-2467-3p	PAR-CLIP	23592263
MIRT468739	hsa-miR-3202	PAR-CLIP	23592263
MIRT468760	hsa-miR-495-3p	PAR-CLIP	23592263
MIRT468759	hsa-miR-5688	PAR-CLIP	23592263
MIRT468758	hsa-miR-7-1-3p	PAR-CLIP	23592263
MIRT468757	hsa-miR-7-2-3p	PAR-CLIP	23592263
MIRT468756	hsa-miR-3125	PAR-CLIP	23592263
MIRT468755	hsa-miR-3916	PAR-CLIP	23592263
MIRT468754	hsa-miR-6859-5p	PAR-CLIP	23592263
MIRT468753	hsa-miR-577	PAR-CLIP	23592263
MIRT468752	hsa-miR-4476	PAR-CLIP	23592263
MIRT468751	hsa-miR-6876-5p	PAR-CLIP	23592263
MIRT468750	hsa-miR-4436b-3p	PAR-CLIP	23592263
MIRT468749	hsa-miR-4632-5p	PAR-CLIP	23592263
MIRT468748	hsa-miR-6735-5p	PAR-CLIP	23592263
MIRT468747	hsa-miR-6879-5p	PAR-CLIP	23592263
MIRT468746	hsa-miR-7843-5p	PAR-CLIP	23592263
MIRT468745	hsa-miR-6847-5p	PAR-CLIP	23592263
MIRT468744	hsa-miR-3179	PAR-CLIP	23592263
MIRT468743	hsa-miR-3150b-3p	PAR-CLIP	23592263
MIRT468742	hsa-miR-4784	PAR-CLIP	23592263
MIRT468741	hsa-miR-3616-3p	PAR-CLIP	23592263
MIRT468740	hsa-miR-2467-3p	PAR-CLIP	23592263
MIRT468739	hsa-miR-3202	PAR-CLIP	23592263
MIRT1331299	hsa-miR-1271	CLIP-seq
MIRT1331300	hsa-miR-182	CLIP-seq
MIRT1331301	hsa-miR-3190	CLIP-seq
MIRT1331302	hsa-miR-3200-5p	CLIP-seq
MIRT1331303	hsa-miR-331-3p	CLIP-seq
MIRT1331304	hsa-miR-3622b-5p	CLIP-seq
MIRT1331305	hsa-miR-3646	CLIP-seq
MIRT1331306	hsa-miR-3647-3p	CLIP-seq
MIRT1331307	hsa-miR-3941	CLIP-seq
MIRT1331308	hsa-miR-4251	CLIP-seq
MIRT1331309	hsa-miR-4257	CLIP-seq
MIRT1331310	hsa-miR-4329	CLIP-seq
MIRT1331311	hsa-miR-4642	CLIP-seq
MIRT1331312	hsa-miR-4643	CLIP-seq
MIRT1331313	hsa-miR-466	CLIP-seq
MIRT1331314	hsa-miR-4670-3p	CLIP-seq
MIRT1331315	hsa-miR-4672	CLIP-seq
MIRT1331316	hsa-miR-4704-5p	CLIP-seq
MIRT1331317	hsa-miR-4719	CLIP-seq
MIRT1331318	hsa-miR-4728-3p	CLIP-seq
MIRT1331319	hsa-miR-4775	CLIP-seq
MIRT1331320	hsa-miR-4789-3p	CLIP-seq
MIRT1331321	hsa-miR-4789-5p	CLIP-seq
MIRT1331322	hsa-miR-494	CLIP-seq
MIRT1331323	hsa-miR-499a-5p	CLIP-seq
MIRT1331324	hsa-miR-561	CLIP-seq
MIRT1331325	hsa-miR-590-3p	CLIP-seq
MIRT1331326	hsa-miR-605	CLIP-seq
MIRT1331327	hsa-miR-628-5p	CLIP-seq
MIRT1331328	hsa-miR-642b	CLIP-seq
MIRT1331329	hsa-miR-885-3p	CLIP-seq
MIRT1331330	hsa-miR-96	CLIP-seq
MIRT1553262	hsa-miR-3148	CLIP-seq
MIRT1553263	hsa-miR-3149	CLIP-seq
MIRT1553264	hsa-miR-4496	CLIP-seq
MIRT1331316	hsa-miR-4704-5p	CLIP-seq
MIRT1553265	hsa-miR-4762-5p	CLIP-seq
MIRT1331319	hsa-miR-4775	CLIP-seq
MIRT1331321	hsa-miR-4789-5p	CLIP-seq
MIRT1553266	hsa-miR-4796-3p	CLIP-seq
MIRT1331325	hsa-miR-590-3p	CLIP-seq
MIRT1553267	hsa-miR-627	CLIP-seq
MIRT1331319	hsa-miR-4775	CLIP-seq
MIRT2322548	hsa-miR-103a	CLIP-seq
MIRT2322549	hsa-miR-107	CLIP-seq
MIRT2322550	hsa-miR-1184	CLIP-seq
MIRT2322551	hsa-miR-1205	CLIP-seq
MIRT2322552	hsa-miR-1283	CLIP-seq
MIRT2322553	hsa-miR-25	CLIP-seq
MIRT1553262	hsa-miR-3148	CLIP-seq
MIRT1553263	hsa-miR-3149	CLIP-seq
MIRT2322554	hsa-miR-3158-5p	CLIP-seq
MIRT2322555	hsa-miR-32	CLIP-seq
MIRT1331302	hsa-miR-3200-5p	CLIP-seq
MIRT2322556	hsa-miR-363	CLIP-seq
MIRT1331305	hsa-miR-3646	CLIP-seq
MIRT2322557	hsa-miR-367	CLIP-seq
MIRT2322558	hsa-miR-4307	CLIP-seq
MIRT1553264	hsa-miR-4496	CLIP-seq
MIRT2322559	hsa-miR-4666-3p	CLIP-seq
MIRT2322560	hsa-miR-4680-3p	CLIP-seq
MIRT1331317	hsa-miR-4719	CLIP-seq
MIRT2322561	hsa-miR-4781-3p	CLIP-seq
MIRT1331321	hsa-miR-4789-5p	CLIP-seq
MIRT1331322	hsa-miR-494	CLIP-seq
MIRT1553267	hsa-miR-627	CLIP-seq
MIRT1331328	hsa-miR-642b	CLIP-seq
MIRT2322562	hsa-miR-659	CLIP-seq
MIRT2322563	hsa-miR-767-5p	CLIP-seq
MIRT2322564	hsa-miR-891b	CLIP-seq
MIRT2322565	hsa-miR-9	CLIP-seq
MIRT2322566	hsa-miR-92a	CLIP-seq
MIRT2322567	hsa-miR-92b	CLIP-seq
MIRT2322552	hsa-miR-1283	CLIP-seq
MIRT2394131	hsa-miR-199a-3p	CLIP-seq
MIRT2394132	hsa-miR-199b-3p	CLIP-seq
MIRT2394133	hsa-miR-3129-5p	CLIP-seq
MIRT2394134	hsa-miR-936	CLIP-seq
MIRT2322552	hsa-miR-1283	CLIP-seq
MIRT2432940	hsa-miR-296-3p	CLIP-seq
MIRT1331305	hsa-miR-3646	CLIP-seq
MIRT1331306	hsa-miR-3647-3p	CLIP-seq
MIRT2432941	hsa-miR-3910	CLIP-seq
MIRT1331316	hsa-miR-4704-5p	CLIP-seq
MIRT1331317	hsa-miR-4719	CLIP-seq
MIRT1331321	hsa-miR-4789-5p	CLIP-seq
MIRT1331322	hsa-miR-494	CLIP-seq
MIRT2432942	hsa-miR-548an	CLIP-seq
MIRT1553267	hsa-miR-627	CLIP-seq
MIRT1331328	hsa-miR-642b	CLIP-seq
MIRT2440060	hsa-miR-3156-5p	CLIP-seq
MIRT1331305	hsa-miR-3646	CLIP-seq
MIRT1553264	hsa-miR-4496	CLIP-seq
MIRT1331317	hsa-miR-4719	CLIP-seq
MIRT1331322	hsa-miR-494	CLIP-seq
MIRT1553267	hsa-miR-627	CLIP-seq
MIRT1331328	hsa-miR-642b	CLIP-seq
MIRT2618679	hsa-miR-1245	CLIP-seq
MIRT2322552	hsa-miR-1283	CLIP-seq
MIRT2618680	hsa-miR-1321	CLIP-seq
MIRT2618681	hsa-miR-2277-3p	CLIP-seq
MIRT2432940	hsa-miR-296-3p	CLIP-seq
MIRT2618682	hsa-miR-300	CLIP-seq
MIRT2618683	hsa-miR-3117-5p	CLIP-seq
MIRT2618684	hsa-miR-3121-3p	CLIP-seq
MIRT1553262	hsa-miR-3148	CLIP-seq
MIRT1553263	hsa-miR-3149	CLIP-seq
MIRT2618685	hsa-miR-3154	CLIP-seq
MIRT1331301	hsa-miR-3190	CLIP-seq
MIRT1331305	hsa-miR-3646	CLIP-seq
MIRT2618686	hsa-miR-381	CLIP-seq
MIRT2432941	hsa-miR-3910	CLIP-seq
MIRT2618687	hsa-miR-3976	CLIP-seq
MIRT2618688	hsa-miR-4282	CLIP-seq
MIRT2618689	hsa-miR-4477b	CLIP-seq
MIRT1553264	hsa-miR-4496	CLIP-seq
MIRT2322559	hsa-miR-4666-3p	CLIP-seq
MIRT1331314	hsa-miR-4670-3p	CLIP-seq
MIRT2618690	hsa-miR-4695-3p	CLIP-seq
MIRT1331317	hsa-miR-4719	CLIP-seq
MIRT2618691	hsa-miR-4728-5p	CLIP-seq
MIRT2618692	hsa-miR-4739	CLIP-seq
MIRT2618693	hsa-miR-4756-5p	CLIP-seq
MIRT1331321	hsa-miR-4789-5p	CLIP-seq
MIRT1553266	hsa-miR-4796-3p	CLIP-seq
MIRT2618694	hsa-miR-4803	CLIP-seq
MIRT1331322	hsa-miR-494	CLIP-seq
MIRT2618695	hsa-miR-520d-5p	CLIP-seq
MIRT2618696	hsa-miR-520g	CLIP-seq
MIRT2618697	hsa-miR-520h	CLIP-seq
MIRT2618698	hsa-miR-524-5p	CLIP-seq
MIRT2432942	hsa-miR-548an	CLIP-seq
MIRT2618699	hsa-miR-548c-3p	CLIP-seq
MIRT2618700	hsa-miR-548n	CLIP-seq
MIRT2618701	hsa-miR-548t	CLIP-seq
MIRT1331324	hsa-miR-561	CLIP-seq
MIRT1553267	hsa-miR-627	CLIP-seq
MIRT1331328	hsa-miR-642b	CLIP-seq
MIRT2322562	hsa-miR-659	CLIP-seq
MIRT2322552	hsa-miR-1283	CLIP-seq
MIRT2618680	hsa-miR-1321	CLIP-seq
MIRT2618681	hsa-miR-2277-3p	CLIP-seq
MIRT2432940	hsa-miR-296-3p	CLIP-seq
MIRT1553262	hsa-miR-3148	CLIP-seq
MIRT1553263	hsa-miR-3149	CLIP-seq
MIRT2618685	hsa-miR-3154	CLIP-seq
MIRT1331305	hsa-miR-3646	CLIP-seq
MIRT2432941	hsa-miR-3910	CLIP-seq
MIRT2618689	hsa-miR-4477b	CLIP-seq
MIRT1553264	hsa-miR-4496	CLIP-seq
MIRT1331317	hsa-miR-4719	CLIP-seq
MIRT2618692	hsa-miR-4739	CLIP-seq
MIRT2618693	hsa-miR-4756-5p	CLIP-seq
MIRT1331322	hsa-miR-494	CLIP-seq
MIRT2432942	hsa-miR-548an	CLIP-seq
MIRT2618700	hsa-miR-548n	CLIP-seq
MIRT2618701	hsa-miR-548t	CLIP-seq
MIRT1331324	hsa-miR-561	CLIP-seq
MIRT1553267	hsa-miR-627	CLIP-seq
MIRT1331328	hsa-miR-642b	CLIP-seq
MIRT2322562	hsa-miR-659	CLIP-seq

Show/Hide all (17)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	9660868, 11356864, 18093920, 22660413, 32296183, 32814053, 33961781
GO:0005788	Component	Endoplasmic reticulum lumen	TAS
GO:0005796	Component	Golgi lumen	TAS
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	TAS
GO:0007399	Process	Nervous system development	IEA
GO:0009986	Component	Cell surface	IBA
GO:0016020	Component	Membrane	IEA
GO:0016477	Process	Cell migration	IBA
GO:0030154	Process	Cell differentiation	IEA
GO:0030165	Function	PDZ domain binding	IPI	18256285
GO:0031012	Component	Extracellular matrix	HDA	27068509
GO:0042802	Function	Identical protein binding	IPI	18093920, 21988832
GO:0043202	Component	Lysosomal lumen	TAS
GO:0048813	Process	Dendrite morphogenesis	IBA
GO:0048814	Process	Regulation of dendrite morphogenesis	IEA
GO:0048814	Process	Regulation of dendrite morphogenesis	ISS

MIM	HGNC	e!Ensembl
142460	10659	ENSG00000169439

P34741

Protein name

Syndecan-2 (SYND2) (Fibroglycan) (Heparan sulfate proteoglycan core protein) (HSPG) (CD antigen CD362)

Protein function

Cell surface proteoglycan which regulates dendritic arbor morphogenesis.

PDB

6ITH

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01034	Syndecan	138 → 199	Syndecan domain	Family

Sequence

MRRAWILLTLGLVACVSAESRAELTSDKDMYLDNSSIEEASGVYPIDDDDYASASGSGAD
EDVESPELTTSRPLPKILLTSAAPKVETTTLNIQNKIPAQTKSPEETDKEKVHLSDSERK
MDPAEEDTNVYTEKHSDSLFKRTEVLAAVIAGGVIGFLFAIFLILLLVYRMRKKDEGSYD
LGERKPSSAAYQKAPTKEFYA

Sequence length

201

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (9)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CHRONIC OBSTRUCTIVE PULMONARY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CLEFT PALATE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CLEFT UPPER LIP	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COMPLETE UNILATERAL CLEFT LIP	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DRY EYE SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOTENSION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POST-TRAUMATIC STRESS DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SJOGREN SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (119)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma of colon	Adenocarcinoma Of Colon	BEFREE	19858218		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	29526559, 30106131, 30562054		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	22471946		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	31456088, 31602277		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ameloblastoma	Ameloblastoma	BEFREE	12189507, 14720194		★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	22471946		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	17545191	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthrogryposis	Arthrogryposis multiplex congenita	BEFREE	28539443		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	BEFREE	9259269		★★★★★ ★☆☆☆☆ Found in Text Mining only
Azoospermia	Azoospermia	Pubtator	39285301	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone neoplasms	Bone neoplasms	BEFREE	17440083, 22550000		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	19383343, 23975428, 25623282		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	19383343, 23327652, 24357546, 25623282	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	30562054		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cartilaginous exostosis	Osteochondroma	BEFREE	17226760		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Amyloid Angiopathy, Hereditary	Cerebral Amyloid Angiopathy	BEFREE	7637318		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	BEFREE	19179614		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	LHGDN	19179614		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic colitis	Colitis	BEFREE	28031321		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	28031321		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	19466596, 19858218, 21569759, 25686828, 28031321, 28821612		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	12055189, 31337828	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	28031321		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	11520060, 23747112, 30876480, 31407497, 31456088, 31602277, 31707342		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	12055189, 23747112, 24485021, 28700744, 28753106, 29225717, 29730903, 29945573, 30876480, 31089394, 31407497, 31707342, 33126908, 33393623, 33504902 View all (18 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	23705906	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Conductive hearing loss	Hearing Loss	BEFREE	24735539		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	15998433		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	BEFREE	24472179		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	32111749	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	29415062		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	12708751, 14674716		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	12708751, 14674716		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	LHGDN	14674716		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	Pubtator	24278138	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	BEFREE	29621420		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epidermolysis Bullosa	Epidermolysis Bullosa	BEFREE	2522973		★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial Cerebral Amyloid Angiopathy	Cerebral amyloid angiopathy	BEFREE	7637318		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	BEFREE	16267014, 23297089, 28962916		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	15998433		★★★★★ ★☆☆☆☆ Found in Text Mining only
Follicular adenoma	Adenoma	BEFREE	14676122		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fragile X Syndrome	Fragile X Syndrome	BEFREE	29114039, 29375303		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	27502167		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	35702951	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	29322326		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	29322326, 29726297		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	25935541	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	32174066	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis C Chronic	Hepatitis c	Pubtator	27693511	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Multiple Exostoses	Multiple congenital exostosis	BEFREE	10934647, 22253766		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hydranencephaly	Hydranencephaly	BEFREE	28539443		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia, Familial	Hypercholesterolemia	BEFREE	25568062		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	10586428		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipidemia	Hyperlipidemia	BEFREE	24278138		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipidemias	Hyperlipidemia	Pubtator	24278138	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipoproteinemia Type IIa	Hyperlipoproteinemia	BEFREE	25568062		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	22900087, 23924348		★★★★★ ★☆☆☆☆ Found in Text Mining only
Infertility Male	Male infertility	Pubtator	39285301	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	11350606		★★★★★ ★☆☆☆☆ Found in Text Mining only
Iron Overload	Iron overload	Pubtator	32174066	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	Pubtator	31467338	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	12708751, 28992095		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	LHGDN	18032547		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	18032547	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure	Kidney Failure	BEFREE	12708751		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	17035092	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	11350606, 17786358, 25999065, 29669302		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	24736615	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	28420046		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	28420046		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	28420046		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	BEFREE	28420046		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	28420046		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	24927672, 31707342	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malformations of Cortical Development, Group II	Malformation of cortical development	BEFREE	19641225		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	19383343, 23975428		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	30562054		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	22471946, 23374155, 23747112, 25686828, 27819680, 28940845		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	19858218, 21569759, 25686828, 28031321, 28821612		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	23975428, 25623282		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	19641225, 22493442, 24472179, 28977882, 7591461		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	19696445	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Membranous glomerulonephritis	Membranous Glomerulonephritis	BEFREE	28420046		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	27810425		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	31028099		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	Pubtator	35127947	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	16732320	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy	Muscular dystrophy	BEFREE	14625404		★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Facioscapulohumeral	Facioscapulohumeral Muscular Dystrophy	BEFREE	10716758		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myositis Ossificans	Myositis Ossificans	LHGDN	17516498		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10934647, 12189507, 12727115, 17440083, 19288017, 23278563, 23327652, 27502167, 28215163, 29566097, 30562054		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephritis, Interstitial	Nephritis	BEFREE	11380810		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephritis, Tubulointerstitial	Nephritis	BEFREE	11380810		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephrosis, congenital	Nephrosis, Congenital	BEFREE	1536728		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurofibromatosis Familial Spinal	Neurofibromatosis	Pubtator	37217626	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	11461706		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	15936998, 17440083, 20530678, 22550000, 29118673		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	22471946, 9802880	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis, Chronic	Pancreatitis	BEFREE	22471946		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pleural effusion disorder	Pleural effusion	BEFREE	31028099		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	35794640	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	21317913, 34445387	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	23924348, 28886261		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	BEFREE	12708751		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	16052590, 22005949		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	23278563		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	19288017		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	35358652	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of skin	Skin carcinoma	BEFREE	23278563		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	33178362, 37419119, 37496999	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
SYMPHALANGISM, PROXIMAL, 1A	Symphalangism	BEFREE	24735539		★★★★★ ★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	22900087, 24442880		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	33521130	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	14676122		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	32793117	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	25623282	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Tuberous Sclerosis	Tuberous Sclerosis	BEFREE	25880340		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	37410084	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	35426938	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

SDC2 (syndecan 2)