SDC2 (syndecan 2)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 6383
• Gene name: Syndecan 2
• Gene symbol: SDC2
• Synonyms (NCBI Gene): CD362, HSPG, HSPG1, SYND2
• Chromosome: 8
• Chromosome location: 8q22.1
• Summary: The protein encoded by this gene is a transmembrane (type I) heparan sulfate proteoglycan and is a member of the syndecan proteoglycan family. The syndecans mediate cell binding, cell signaling, and cytoskeletal organization and syndecan receptors are req

miRNA Show/Hide all (205)

miRTarBase ID	miRNA	Experiments	Reference
MIRT468760	hsa-miR-495-3p	PAR-CLIP	23592263
MIRT468759	hsa-miR-5688	PAR-CLIP	23592263
MIRT468758	hsa-miR-7-1-3p	PAR-CLIP	23592263
MIRT468757	hsa-miR-7-2-3p	PAR-CLIP	23592263
MIRT468756	hsa-miR-3125	PAR-CLIP	23592263
MIRT468755	hsa-miR-3916	PAR-CLIP	23592263
MIRT468754	hsa-miR-6859-5p	PAR-CLIP	23592263
MIRT468753	hsa-miR-577	PAR-CLIP	23592263
MIRT468752	hsa-miR-4476	PAR-CLIP	23592263
MIRT468751	hsa-miR-6876-5p	PAR-CLIP	23592263
MIRT468750	hsa-miR-4436b-3p	PAR-CLIP	23592263
MIRT468749	hsa-miR-4632-5p	PAR-CLIP	23592263
MIRT468748	hsa-miR-6735-5p	PAR-CLIP	23592263
MIRT468747	hsa-miR-6879-5p	PAR-CLIP	23592263
MIRT468746	hsa-miR-7843-5p	PAR-CLIP	23592263
MIRT468745	hsa-miR-6847-5p	PAR-CLIP	23592263
MIRT468744	hsa-miR-3179	PAR-CLIP	23592263
MIRT468743	hsa-miR-3150b-3p	PAR-CLIP	23592263
MIRT468742	hsa-miR-4784	PAR-CLIP	23592263
MIRT468741	hsa-miR-3616-3p	PAR-CLIP	23592263
MIRT468740	hsa-miR-2467-3p	PAR-CLIP	23592263
MIRT468739	hsa-miR-3202	PAR-CLIP	23592263
MIRT468760	hsa-miR-495-3p	PAR-CLIP	23592263
MIRT468759	hsa-miR-5688	PAR-CLIP	23592263
MIRT468758	hsa-miR-7-1-3p	PAR-CLIP	23592263
MIRT468757	hsa-miR-7-2-3p	PAR-CLIP	23592263
MIRT468756	hsa-miR-3125	PAR-CLIP	23592263
MIRT468755	hsa-miR-3916	PAR-CLIP	23592263
MIRT468754	hsa-miR-6859-5p	PAR-CLIP	23592263
MIRT468753	hsa-miR-577	PAR-CLIP	23592263
MIRT468752	hsa-miR-4476	PAR-CLIP	23592263
MIRT468751	hsa-miR-6876-5p	PAR-CLIP	23592263
MIRT468750	hsa-miR-4436b-3p	PAR-CLIP	23592263
MIRT468749	hsa-miR-4632-5p	PAR-CLIP	23592263
MIRT468748	hsa-miR-6735-5p	PAR-CLIP	23592263
MIRT468747	hsa-miR-6879-5p	PAR-CLIP	23592263
MIRT468746	hsa-miR-7843-5p	PAR-CLIP	23592263
MIRT468745	hsa-miR-6847-5p	PAR-CLIP	23592263
MIRT468744	hsa-miR-3179	PAR-CLIP	23592263
MIRT468743	hsa-miR-3150b-3p	PAR-CLIP	23592263
MIRT468742	hsa-miR-4784	PAR-CLIP	23592263
MIRT468741	hsa-miR-3616-3p	PAR-CLIP	23592263
MIRT468740	hsa-miR-2467-3p	PAR-CLIP	23592263
MIRT468739	hsa-miR-3202	PAR-CLIP	23592263
MIRT1331299	hsa-miR-1271	CLIP-seq
MIRT1331300	hsa-miR-182	CLIP-seq
MIRT1331301	hsa-miR-3190	CLIP-seq
MIRT1331302	hsa-miR-3200-5p	CLIP-seq
MIRT1331303	hsa-miR-331-3p	CLIP-seq
MIRT1331304	hsa-miR-3622b-5p	CLIP-seq
MIRT1331305	hsa-miR-3646	CLIP-seq
MIRT1331306	hsa-miR-3647-3p	CLIP-seq
MIRT1331307	hsa-miR-3941	CLIP-seq
MIRT1331308	hsa-miR-4251	CLIP-seq
MIRT1331309	hsa-miR-4257	CLIP-seq
MIRT1331310	hsa-miR-4329	CLIP-seq
MIRT1331311	hsa-miR-4642	CLIP-seq
MIRT1331312	hsa-miR-4643	CLIP-seq
MIRT1331313	hsa-miR-466	CLIP-seq
MIRT1331314	hsa-miR-4670-3p	CLIP-seq
MIRT1331315	hsa-miR-4672	CLIP-seq
MIRT1331316	hsa-miR-4704-5p	CLIP-seq
MIRT1331317	hsa-miR-4719	CLIP-seq
MIRT1331318	hsa-miR-4728-3p	CLIP-seq
MIRT1331319	hsa-miR-4775	CLIP-seq
MIRT1331320	hsa-miR-4789-3p	CLIP-seq
MIRT1331321	hsa-miR-4789-5p	CLIP-seq
MIRT1331322	hsa-miR-494	CLIP-seq
MIRT1331323	hsa-miR-499a-5p	CLIP-seq
MIRT1331324	hsa-miR-561	CLIP-seq
MIRT1331325	hsa-miR-590-3p	CLIP-seq
MIRT1331326	hsa-miR-605	CLIP-seq
MIRT1331327	hsa-miR-628-5p	CLIP-seq
MIRT1331328	hsa-miR-642b	CLIP-seq
MIRT1331329	hsa-miR-885-3p	CLIP-seq
MIRT1331330	hsa-miR-96	CLIP-seq
MIRT1553262	hsa-miR-3148	CLIP-seq
MIRT1553263	hsa-miR-3149	CLIP-seq
MIRT1553264	hsa-miR-4496	CLIP-seq
MIRT1331316	hsa-miR-4704-5p	CLIP-seq
MIRT1553265	hsa-miR-4762-5p	CLIP-seq
MIRT1331319	hsa-miR-4775	CLIP-seq
MIRT1331321	hsa-miR-4789-5p	CLIP-seq
MIRT1553266	hsa-miR-4796-3p	CLIP-seq
MIRT1331325	hsa-miR-590-3p	CLIP-seq
MIRT1553267	hsa-miR-627	CLIP-seq
MIRT1331319	hsa-miR-4775	CLIP-seq
MIRT2322548	hsa-miR-103a	CLIP-seq
MIRT2322549	hsa-miR-107	CLIP-seq
MIRT2322550	hsa-miR-1184	CLIP-seq
MIRT2322551	hsa-miR-1205	CLIP-seq
MIRT2322552	hsa-miR-1283	CLIP-seq
MIRT2322553	hsa-miR-25	CLIP-seq
MIRT1553262	hsa-miR-3148	CLIP-seq
MIRT1553263	hsa-miR-3149	CLIP-seq
MIRT2322554	hsa-miR-3158-5p	CLIP-seq
MIRT2322555	hsa-miR-32	CLIP-seq
MIRT1331302	hsa-miR-3200-5p	CLIP-seq
MIRT2322556	hsa-miR-363	CLIP-seq
MIRT1331305	hsa-miR-3646	CLIP-seq
MIRT2322557	hsa-miR-367	CLIP-seq
MIRT2322558	hsa-miR-4307	CLIP-seq
MIRT1553264	hsa-miR-4496	CLIP-seq
MIRT2322559	hsa-miR-4666-3p	CLIP-seq
MIRT2322560	hsa-miR-4680-3p	CLIP-seq
MIRT1331317	hsa-miR-4719	CLIP-seq
MIRT2322561	hsa-miR-4781-3p	CLIP-seq
MIRT1331321	hsa-miR-4789-5p	CLIP-seq
MIRT1331322	hsa-miR-494	CLIP-seq
MIRT1553267	hsa-miR-627	CLIP-seq
MIRT1331328	hsa-miR-642b	CLIP-seq
MIRT2322562	hsa-miR-659	CLIP-seq
MIRT2322563	hsa-miR-767-5p	CLIP-seq
MIRT2322564	hsa-miR-891b	CLIP-seq
MIRT2322565	hsa-miR-9	CLIP-seq
MIRT2322566	hsa-miR-92a	CLIP-seq
MIRT2322567	hsa-miR-92b	CLIP-seq
MIRT2322552	hsa-miR-1283	CLIP-seq
MIRT2394131	hsa-miR-199a-3p	CLIP-seq
MIRT2394132	hsa-miR-199b-3p	CLIP-seq
MIRT2394133	hsa-miR-3129-5p	CLIP-seq
MIRT2394134	hsa-miR-936	CLIP-seq
MIRT2322552	hsa-miR-1283	CLIP-seq
MIRT2432940	hsa-miR-296-3p	CLIP-seq
MIRT1331305	hsa-miR-3646	CLIP-seq
MIRT1331306	hsa-miR-3647-3p	CLIP-seq
MIRT2432941	hsa-miR-3910	CLIP-seq
MIRT1331316	hsa-miR-4704-5p	CLIP-seq
MIRT1331317	hsa-miR-4719	CLIP-seq
MIRT1331321	hsa-miR-4789-5p	CLIP-seq
MIRT1331322	hsa-miR-494	CLIP-seq
MIRT2432942	hsa-miR-548an	CLIP-seq
MIRT1553267	hsa-miR-627	CLIP-seq
MIRT1331328	hsa-miR-642b	CLIP-seq
MIRT2440060	hsa-miR-3156-5p	CLIP-seq
MIRT1331305	hsa-miR-3646	CLIP-seq
MIRT1553264	hsa-miR-4496	CLIP-seq
MIRT1331317	hsa-miR-4719	CLIP-seq
MIRT1331322	hsa-miR-494	CLIP-seq
MIRT1553267	hsa-miR-627	CLIP-seq
MIRT1331328	hsa-miR-642b	CLIP-seq
MIRT2618679	hsa-miR-1245	CLIP-seq
MIRT2322552	hsa-miR-1283	CLIP-seq
MIRT2618680	hsa-miR-1321	CLIP-seq
MIRT2618681	hsa-miR-2277-3p	CLIP-seq
MIRT2432940	hsa-miR-296-3p	CLIP-seq
MIRT2618682	hsa-miR-300	CLIP-seq
MIRT2618683	hsa-miR-3117-5p	CLIP-seq
MIRT2618684	hsa-miR-3121-3p	CLIP-seq
MIRT1553262	hsa-miR-3148	CLIP-seq
MIRT1553263	hsa-miR-3149	CLIP-seq
MIRT2618685	hsa-miR-3154	CLIP-seq
MIRT1331301	hsa-miR-3190	CLIP-seq
MIRT1331305	hsa-miR-3646	CLIP-seq
MIRT2618686	hsa-miR-381	CLIP-seq
MIRT2432941	hsa-miR-3910	CLIP-seq
MIRT2618687	hsa-miR-3976	CLIP-seq
MIRT2618688	hsa-miR-4282	CLIP-seq
MIRT2618689	hsa-miR-4477b	CLIP-seq
MIRT1553264	hsa-miR-4496	CLIP-seq
MIRT2322559	hsa-miR-4666-3p	CLIP-seq
MIRT1331314	hsa-miR-4670-3p	CLIP-seq
MIRT2618690	hsa-miR-4695-3p	CLIP-seq
MIRT1331317	hsa-miR-4719	CLIP-seq
MIRT2618691	hsa-miR-4728-5p	CLIP-seq
MIRT2618692	hsa-miR-4739	CLIP-seq
MIRT2618693	hsa-miR-4756-5p	CLIP-seq
MIRT1331321	hsa-miR-4789-5p	CLIP-seq
MIRT1553266	hsa-miR-4796-3p	CLIP-seq
MIRT2618694	hsa-miR-4803	CLIP-seq
MIRT1331322	hsa-miR-494	CLIP-seq
MIRT2618695	hsa-miR-520d-5p	CLIP-seq
MIRT2618696	hsa-miR-520g	CLIP-seq
MIRT2618697	hsa-miR-520h	CLIP-seq
MIRT2618698	hsa-miR-524-5p	CLIP-seq
MIRT2432942	hsa-miR-548an	CLIP-seq
MIRT2618699	hsa-miR-548c-3p	CLIP-seq
MIRT2618700	hsa-miR-548n	CLIP-seq
MIRT2618701	hsa-miR-548t	CLIP-seq
MIRT1331324	hsa-miR-561	CLIP-seq
MIRT1553267	hsa-miR-627	CLIP-seq
MIRT1331328	hsa-miR-642b	CLIP-seq
MIRT2322562	hsa-miR-659	CLIP-seq
MIRT2322552	hsa-miR-1283	CLIP-seq
MIRT2618680	hsa-miR-1321	CLIP-seq
MIRT2618681	hsa-miR-2277-3p	CLIP-seq
MIRT2432940	hsa-miR-296-3p	CLIP-seq
MIRT1553262	hsa-miR-3148	CLIP-seq
MIRT1553263	hsa-miR-3149	CLIP-seq
MIRT2618685	hsa-miR-3154	CLIP-seq
MIRT1331305	hsa-miR-3646	CLIP-seq
MIRT2432941	hsa-miR-3910	CLIP-seq
MIRT2618689	hsa-miR-4477b	CLIP-seq
MIRT1553264	hsa-miR-4496	CLIP-seq
MIRT1331317	hsa-miR-4719	CLIP-seq
MIRT2618692	hsa-miR-4739	CLIP-seq
MIRT2618693	hsa-miR-4756-5p	CLIP-seq
MIRT1331322	hsa-miR-494	CLIP-seq
MIRT2432942	hsa-miR-548an	CLIP-seq
MIRT2618700	hsa-miR-548n	CLIP-seq
MIRT2618701	hsa-miR-548t	CLIP-seq
MIRT1331324	hsa-miR-561	CLIP-seq
MIRT1553267	hsa-miR-627	CLIP-seq
MIRT1331328	hsa-miR-642b	CLIP-seq
MIRT2322562	hsa-miR-659	CLIP-seq

Gene ontology (GO) Show/Hide all (17)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	9660868, 11356864, 18093920, 22660413, 32296183, 32814053, 33961781
GO:0005788	Component	Endoplasmic reticulum lumen	TAS
GO:0005796	Component	Golgi lumen	TAS
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	TAS
GO:0007399	Process	Nervous system development	IEA
GO:0009986	Component	Cell surface	IBA
GO:0016020	Component	Membrane	IEA
GO:0016477	Process	Cell migration	IBA
GO:0030154	Process	Cell differentiation	IEA
GO:0030165	Function	PDZ domain binding	IPI	18256285
GO:0031012	Component	Extracellular matrix	HDA	27068509
GO:0042802	Function	Identical protein binding	IPI	18093920, 21988832
GO:0043202	Component	Lysosomal lumen	TAS
GO:0048813	Process	Dendrite morphogenesis	IBA
GO:0048814	Process	Regulation of dendrite morphogenesis	IEA
GO:0048814	Process	Regulation of dendrite morphogenesis	ISS

Other IDs

• MIM: 142460
• HGNC: 10659
• e!Ensembl: ENSG00000169439

Protein

• UniProt ID: P34741
• Protein name: Syndecan-2 (SYND2) (Fibroglycan) (Heparan sulfate proteoglycan core protein) (HSPG) (CD antigen CD362)
• Protein function: Cell surface proteoglycan which regulates dendritic arbor morphogenesis.
• PDB: 6ITH
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01034	Syndecan	138 → 199	Syndecan domain	Family

• Sequence:

  MRRAWILLTLGLVACVSAESRAELTSDKDMYLDNSSIEEASGVYPIDDDDYASASGSGAD
  EDVESPELTTSRPLPKILLTSAAPKVETTTLNIQNKIPAQTKSPEETDKEKVHLSDSERK
  MDPAEEDTNVYTEKHSDSLFKRTEVLAAVIAGGVIGFLFAIFLILLLVYRMRKKDEGSYD
  LGERKPSSAAYQKAPTKEFYA

• Sequence length: 201

Pathways

KEGG Pathway	Reactome Pathway
Cell adhesion molecules	A tetrasaccharide linker sequence is required for GAG synthesis
Cytoskeleton in muscle cells	HS-GAG biosynthesis
Malaria	HS-GAG degradation
Proteoglycans in cancer	Cell surface interactions at the vascular wall
Fluid shear stress and atherosclerosis	Syndecan interactions
	Defective B4GALT7 causes EDS, progeroid type
	Defective B3GAT3 causes JDSSDHD
	Defective EXT2 causes exostoses 2
	Defective EXT1 causes exostoses 1, TRPS2 and CHDS
	Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs)
	EPHB-mediated forward signaling
	Defective B3GALT6 causes EDSP2 and SEMDJL1
	Post-translational protein phosphorylation
	Retinoid metabolism and transport

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations Show/Hide Unknown Diseases (9)
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
CHRONIC OBSTRUCTIVE PULMONARY DISEASE	—	GWAS catalog	37069358	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CLEFT PALATE	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CLEFT UPPER LIP	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COMPLETE UNILATERAL CLEFT LIP	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DRY EYE SYNDROME	—	GWAS catalog	38767906	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOTENSION	—	GWAS catalog	39024449	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	35835914	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POST-TRAUMATIC STRESS DISORDER	—	GWAS catalog	26114229	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SJOGREN SYNDROME	—	GWAS catalog	38767906	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (119)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma of colon	Adenocarcinoma Of Colon	BEFREE	19858218		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	29526559, 30106131, 30562054		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	22471946		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	31456088, 31602277		★☆☆☆☆ Found in Text Mining only
Ameloblastoma	Ameloblastoma	BEFREE	12189507, 14720194		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	22471946		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	17545191	Associate	★☆☆☆☆ Found in Text Mining only
Arthrogryposis	Arthrogryposis multiplex congenita	BEFREE	28539443		★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	BEFREE	9259269		★☆☆☆☆ Found in Text Mining only
Azoospermia	Azoospermia	Pubtator	39285301	Associate	★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

MTHFS 3 shared diseasesCleft lip, Cleft palate, Complete unilateral cleft lip 3 shared evidence sourcesDisgenet (Cleft palate), Disgenet (Cleft lip), Disgenet (Complete unilateral cleft lip) Related via 3 shared diseases including Cleft lip, Cleft palate — evidence mostly Disgenet. BHMT2 3 shared diseasesCleft lip, Cleft palate, Complete unilateral cleft lip 3 shared evidence sourcesDisgenet (Cleft palate), Disgenet (Cleft lip), Disgenet (Complete unilateral cleft lip) Related via 3 shared diseases including Cleft lip, Cleft palate — evidence mostly Disgenet. SUMO1 3 shared diseasesCleft lip, Cleft palate, Complete unilateral cleft lip 1 shared pathwayFluid shear stress and atherosclerosis 3 shared evidence sourcesDisgenet (Cleft palate), Disgenet (Cleft lip), Disgenet (Complete unilateral cleft lip) Related via 3 shared diseases including Cleft lip, Cleft palate — evidence mostly Disgenet. C1QL1 2 shared diseasesDry eye syndrome, Sjogren syndrome 2 shared evidence sourcesGWAS catalog (Dry eye syndrome), GWAS catalog (Sjogren syndrome) Related via 2 shared diseases including Dry eye syndrome, Sjogren syndrome — evidence mostly GWAS catalog. FAM241B 2 shared diseasesDry eye syndrome, Sjogren syndrome 2 shared evidence sourcesGWAS catalog (Dry eye syndrome), GWAS catalog (Sjogren syndrome) Related via 2 shared diseases including Dry eye syndrome, Sjogren syndrome — evidence mostly GWAS catalog.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
MTHFS	3	["Cleft lip","Cleft palate","Complete unilateral cleft lip"]	0	[]	3	["Disgenet (Cleft palate)","Disgenet (Cleft lip)","Disgenet (Complete unilateral cleft lip)"]
BHMT2	3	["Cleft lip","Cleft palate","Complete unilateral cleft lip"]	0	[]	3	["Disgenet (Cleft palate)","Disgenet (Cleft lip)","Disgenet (Complete unilateral cleft lip)"]
SUMO1	3	["Cleft lip","Cleft palate","Complete unilateral cleft lip"]	1	["Fluid shear stress and atherosclerosis"]	3	["Disgenet (Cleft palate)","Disgenet (Cleft lip)","Disgenet (Complete unilateral cleft lip)"]
C1QL1	2	["Dry eye syndrome","Sjogren syndrome"]	0	[]	2	["GWAS catalog (Dry eye syndrome)","GWAS catalog (Sjogren syndrome)"]
FAM241B	2	["Dry eye syndrome","Sjogren syndrome"]	0	[]	2	["GWAS catalog (Dry eye syndrome)","GWAS catalog (Sjogren syndrome)"]

Diseases Linked via Similar Genes

Neurodevelopmental disorder Linked via 1 of 5 related genesMTHFS Congenital heart defects Linked via 1 of 5 related genesBHMT2 Coronary artery disease Linked via 1 of 5 related genesSUMO1 Myocardial infarction Linked via 1 of 5 related genesSUMO1 Orofacial cleft Linked via 1 of 5 related genesSUMO1

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Neurodevelopmental disorder	1	["MTHFS"]
Congenital heart defects	1	["BHMT2"]
Coronary artery disease	1	["SUMO1"]
Myocardial infarction	1	["SUMO1"]
Orofacial cleft	1	["SUMO1"]