Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Transcription factors Other IDs Associated diseases
Entrez ID	6382
Gene name	Syndecan 1
Gene symbol	SDC1
Synonyms (NCBI Gene)	CD138SDCSYND1syndecan
Chromosome	2
Chromosome location	2p24.1
Summary	The protein encoded by this gene is a transmembrane (type I) heparan sulfate proteoglycan and is a member of the syndecan proteoglycan family. The syndecans mediate cell binding, cell signaling, and cytoskeletal organization and syndecan receptors are req

412

Show/Hide all (412)

miRTarBase ID	miRNA	Experiments	Reference
MIRT007072	hsa-miR-10b-5p	Luciferase reporter assay	22573479
MIRT019998	hsa-miR-375	Microarray	20215506
MIRT021459	hsa-miR-9-5p	Microarray	17612493
MIRT045538	hsa-miR-149-5p	CLASH	23622248
MIRT052912	hsa-miR-143-3p	Luciferase reporter assayqRT-PCRWestern blot	24722758
MIRT053346	hsa-miR-494-3p	ImmunoblotLuciferase reporter assayqRT-PCR	23728345
MIRT007072	hsa-miR-10b-5p	Luciferase reporter assay	23206733
MIRT614587	hsa-miR-1264	HITS-CLIP	23824327
MIRT614586	hsa-miR-4778-3p	HITS-CLIP	23824327
MIRT614584	hsa-miR-4668-5p	HITS-CLIP	23824327
MIRT614585	hsa-miR-6740-3p	HITS-CLIP	23824327
MIRT616062	hsa-miR-652-5p	HITS-CLIP	23824327
MIRT616061	hsa-miR-6732-3p	HITS-CLIP	23824327
MIRT614587	hsa-miR-1264	HITS-CLIP	23824327
MIRT614586	hsa-miR-4778-3p	HITS-CLIP	23824327
MIRT614585	hsa-miR-6740-3p	HITS-CLIP	23824327
MIRT614584	hsa-miR-4668-5p	HITS-CLIP	23824327
MIRT614587	hsa-miR-1264	HITS-CLIP	23824327
MIRT614586	hsa-miR-4778-3p	HITS-CLIP	23824327
MIRT614585	hsa-miR-6740-3p	HITS-CLIP	23824327
MIRT614584	hsa-miR-4668-5p	HITS-CLIP	23824327
MIRT616062	hsa-miR-652-5p	HITS-CLIP	23824327
MIRT616061	hsa-miR-6732-3p	HITS-CLIP	23824327
MIRT614587	hsa-miR-1264	HITS-CLIP	23824327
MIRT614586	hsa-miR-4778-3p	HITS-CLIP	23824327
MIRT614584	hsa-miR-4668-5p	HITS-CLIP	23824327
MIRT614585	hsa-miR-6740-3p	HITS-CLIP	23824327
MIRT616062	hsa-miR-652-5p	HITS-CLIP	23824327
MIRT616061	hsa-miR-6732-3p	HITS-CLIP	23824327
MIRT614587	hsa-miR-1264	HITS-CLIP	23824327
MIRT614586	hsa-miR-4778-3p	HITS-CLIP	23824327
MIRT614585	hsa-miR-6740-3p	HITS-CLIP	23824327
MIRT614584	hsa-miR-4668-5p	HITS-CLIP	23824327
MIRT614587	hsa-miR-1264	HITS-CLIP	23824327
MIRT614586	hsa-miR-4778-3p	HITS-CLIP	23824327
MIRT614585	hsa-miR-6740-3p	HITS-CLIP	23824327
MIRT614584	hsa-miR-4668-5p	HITS-CLIP	23824327
MIRT442574	hsa-miR-5582-5p	PAR-CLIP	22100165
MIRT442573	hsa-miR-4756-3p	PAR-CLIP	22100165
MIRT442572	hsa-miR-4480	PAR-CLIP	22100165
MIRT442574	hsa-miR-5582-5p	PAR-CLIP	22100165
MIRT442573	hsa-miR-4756-3p	PAR-CLIP	22100165
MIRT442572	hsa-miR-4480	PAR-CLIP	22100165
MIRT007072	hsa-miR-10b-5p	3'LIFE	25074381
MIRT007072	hsa-miR-10b-5p	3'LIFE	25074381
MIRT733585	hsa-miR-10a-5p	Luciferase reporter assayqRT-PCRWestern blotting	32153518
MIRT733585	hsa-miR-10a-5p	Luciferase reporter assayqRT-PCRWestern blotting	32153518
MIRT733936	hsa-miR-665	Western blottingMicroarrayImmunofluorescenceqRT-PCRFlow cytometry	1
MIRT733936	hsa-miR-665	Flow cytometryImmunofluorescenceMicroarrayqRT-PCRWestern blotting	33042414
MIRT614587	hsa-miR-1264	HITS-CLIP	23824327
MIRT614586	hsa-miR-4778-3p	HITS-CLIP	23824327
MIRT614584	hsa-miR-4668-5p	HITS-CLIP	23824327
MIRT614585	hsa-miR-6740-3p	HITS-CLIP	23824327
MIRT616062	hsa-miR-652-5p	HITS-CLIP	23824327
MIRT616061	hsa-miR-6732-3p	HITS-CLIP	23824327
MIRT614587	hsa-miR-1264	HITS-CLIP	23824327
MIRT614586	hsa-miR-4778-3p	HITS-CLIP	23824327
MIRT614585	hsa-miR-6740-3p	HITS-CLIP	23824327
MIRT614584	hsa-miR-4668-5p	HITS-CLIP	23824327
MIRT614587	hsa-miR-1264	HITS-CLIP	23824327
MIRT614586	hsa-miR-4778-3p	HITS-CLIP	23824327
MIRT614585	hsa-miR-6740-3p	HITS-CLIP	23824327
MIRT614584	hsa-miR-4668-5p	HITS-CLIP	23824327
MIRT616062	hsa-miR-652-5p	HITS-CLIP	23824327
MIRT616061	hsa-miR-6732-3p	HITS-CLIP	23824327
MIRT614587	hsa-miR-1264	HITS-CLIP	23824327
MIRT614586	hsa-miR-4778-3p	HITS-CLIP	23824327
MIRT614584	hsa-miR-4668-5p	HITS-CLIP	23824327
MIRT614585	hsa-miR-6740-3p	HITS-CLIP	23824327
MIRT616062	hsa-miR-652-5p	HITS-CLIP	23824327
MIRT616061	hsa-miR-6732-3p	HITS-CLIP	23824327
MIRT614587	hsa-miR-1264	HITS-CLIP	23824327
MIRT614586	hsa-miR-4778-3p	HITS-CLIP	23824327
MIRT614585	hsa-miR-6740-3p	HITS-CLIP	23824327
MIRT614584	hsa-miR-4668-5p	HITS-CLIP	23824327
MIRT614587	hsa-miR-1264	HITS-CLIP	23824327
MIRT614586	hsa-miR-4778-3p	HITS-CLIP	23824327
MIRT614585	hsa-miR-6740-3p	HITS-CLIP	23824327
MIRT614584	hsa-miR-4668-5p	HITS-CLIP	23824327
MIRT442574	hsa-miR-5582-5p	PAR-CLIP	22100165
MIRT442573	hsa-miR-4756-3p	PAR-CLIP	22100165
MIRT442572	hsa-miR-4480	PAR-CLIP	22100165
MIRT442574	hsa-miR-5582-5p	PAR-CLIP	22100165
MIRT442573	hsa-miR-4756-3p	PAR-CLIP	22100165
MIRT442572	hsa-miR-4480	PAR-CLIP	22100165
MIRT1331174	hsa-miR-1200	CLIP-seq
MIRT1331175	hsa-miR-1225-3p	CLIP-seq
MIRT1331176	hsa-miR-1233	CLIP-seq
MIRT1331177	hsa-miR-127-3p	CLIP-seq
MIRT1331178	hsa-miR-149	CLIP-seq
MIRT1331179	hsa-miR-182	CLIP-seq
MIRT1331180	hsa-miR-1915	CLIP-seq
MIRT1331181	hsa-miR-221	CLIP-seq
MIRT1331182	hsa-miR-222	CLIP-seq
MIRT1331183	hsa-miR-302a	CLIP-seq
MIRT1331184	hsa-miR-302b	CLIP-seq
MIRT1331185	hsa-miR-302c	CLIP-seq
MIRT1331186	hsa-miR-302d	CLIP-seq
MIRT1331187	hsa-miR-302e	CLIP-seq
MIRT1331188	hsa-miR-3064-5p	CLIP-seq
MIRT1331189	hsa-miR-3125	CLIP-seq
MIRT1331190	hsa-miR-3133	CLIP-seq
MIRT1331191	hsa-miR-3148	CLIP-seq
MIRT1331192	hsa-miR-3162-5p	CLIP-seq
MIRT1331193	hsa-miR-3163	CLIP-seq
MIRT1331194	hsa-miR-330-3p	CLIP-seq
MIRT1331195	hsa-miR-331-3p	CLIP-seq
MIRT1331196	hsa-miR-340	CLIP-seq
MIRT1331197	hsa-miR-34c-3p	CLIP-seq
MIRT1331198	hsa-miR-3646	CLIP-seq
MIRT1331199	hsa-miR-3650	CLIP-seq
MIRT1331200	hsa-miR-3684	CLIP-seq
MIRT1331201	hsa-miR-372	CLIP-seq
MIRT1331202	hsa-miR-373	CLIP-seq
MIRT1331203	hsa-miR-378g	CLIP-seq
MIRT1331204	hsa-miR-3913-3p	CLIP-seq
MIRT1331205	hsa-miR-3916	CLIP-seq
MIRT1331206	hsa-miR-3918	CLIP-seq
MIRT1331207	hsa-miR-3919	CLIP-seq
MIRT1331208	hsa-miR-3934	CLIP-seq
MIRT1331209	hsa-miR-3941	CLIP-seq
MIRT1331210	hsa-miR-3978	CLIP-seq
MIRT1331211	hsa-miR-4261	CLIP-seq
MIRT1331212	hsa-miR-4274	CLIP-seq
MIRT1331213	hsa-miR-4286	CLIP-seq
MIRT1331214	hsa-miR-4323	CLIP-seq
MIRT1331215	hsa-miR-4421	CLIP-seq
MIRT1331216	hsa-miR-4426	CLIP-seq
MIRT1331217	hsa-miR-4496	CLIP-seq
MIRT1331218	hsa-miR-4511	CLIP-seq
MIRT1331219	hsa-miR-451b	CLIP-seq
MIRT1331220	hsa-miR-4633-3p	CLIP-seq
MIRT1331221	hsa-miR-4639-3p	CLIP-seq
MIRT1331222	hsa-miR-4647	CLIP-seq
MIRT1331223	hsa-miR-466	CLIP-seq
MIRT1331224	hsa-miR-4662b	CLIP-seq
MIRT1331225	hsa-miR-4672	CLIP-seq
MIRT1331226	hsa-miR-4685-5p	CLIP-seq
MIRT1331227	hsa-miR-4690-3p	CLIP-seq
MIRT1331228	hsa-miR-4719	CLIP-seq
MIRT1331229	hsa-miR-4722-3p	CLIP-seq
MIRT1331230	hsa-miR-4731-3p	CLIP-seq
MIRT1331231	hsa-miR-4777-3p	CLIP-seq
MIRT1331232	hsa-miR-4777-5p	CLIP-seq
MIRT1331233	hsa-miR-4794	CLIP-seq
MIRT1331234	hsa-miR-4796-3p	CLIP-seq
MIRT1331235	hsa-miR-4801	CLIP-seq
MIRT1331236	hsa-miR-489	CLIP-seq
MIRT1331237	hsa-miR-494	CLIP-seq
MIRT1331238	hsa-miR-520a-3p	CLIP-seq
MIRT1331239	hsa-miR-520b	CLIP-seq
MIRT1331240	hsa-miR-520c-3p	CLIP-seq
MIRT1331241	hsa-miR-520d-3p	CLIP-seq
MIRT1331242	hsa-miR-520e	CLIP-seq
MIRT1331243	hsa-miR-520g	CLIP-seq
MIRT1331244	hsa-miR-520h	CLIP-seq
MIRT1331245	hsa-miR-548aa	CLIP-seq
MIRT1331246	hsa-miR-548v	CLIP-seq
MIRT1331247	hsa-miR-552	CLIP-seq
MIRT1331248	hsa-miR-624	CLIP-seq
MIRT1331249	hsa-miR-626	CLIP-seq
MIRT1331250	hsa-miR-635	CLIP-seq
MIRT1331251	hsa-miR-662	CLIP-seq
MIRT1331252	hsa-miR-759	CLIP-seq
MIRT1331253	hsa-miR-802	CLIP-seq
MIRT1331254	hsa-miR-877	CLIP-seq
MIRT1331255	hsa-miR-9	CLIP-seq
MIRT1331256	hsa-miR-934	CLIP-seq
MIRT1331176	hsa-miR-1233	CLIP-seq
MIRT1331257	hsa-miR-1256	CLIP-seq
MIRT1331177	hsa-miR-127-3p	CLIP-seq
MIRT1331258	hsa-miR-1286	CLIP-seq
MIRT1331259	hsa-miR-133a	CLIP-seq
MIRT1331260	hsa-miR-133b	CLIP-seq
MIRT1331261	hsa-miR-1587	CLIP-seq
MIRT1331262	hsa-miR-1913	CLIP-seq
MIRT1331263	hsa-miR-19a	CLIP-seq
MIRT1331264	hsa-miR-19b	CLIP-seq
MIRT1331265	hsa-miR-2682	CLIP-seq
MIRT1331266	hsa-miR-298	CLIP-seq
MIRT1331183	hsa-miR-302a	CLIP-seq
MIRT1331184	hsa-miR-302b	CLIP-seq
MIRT1331185	hsa-miR-302c	CLIP-seq
MIRT1331186	hsa-miR-302d	CLIP-seq
MIRT1331187	hsa-miR-302e	CLIP-seq
MIRT1331267	hsa-miR-31	CLIP-seq
MIRT1331268	hsa-miR-3180-5p	CLIP-seq
MIRT1331269	hsa-miR-3194-3p	CLIP-seq
MIRT1331270	hsa-miR-324-3p	CLIP-seq
MIRT1331194	hsa-miR-330-3p	CLIP-seq
MIRT1331271	hsa-miR-34a	CLIP-seq
MIRT1331272	hsa-miR-34c-5p	CLIP-seq
MIRT1331200	hsa-miR-3684	CLIP-seq
MIRT1331273	hsa-miR-3714	CLIP-seq
MIRT1331201	hsa-miR-372	CLIP-seq
MIRT1331202	hsa-miR-373	CLIP-seq
MIRT1331274	hsa-miR-377	CLIP-seq
MIRT1331203	hsa-miR-378g	CLIP-seq
MIRT1331275	hsa-miR-4267	CLIP-seq
MIRT1331212	hsa-miR-4274	CLIP-seq
MIRT1331213	hsa-miR-4286	CLIP-seq
MIRT1331276	hsa-miR-4292	CLIP-seq
MIRT1331216	hsa-miR-4426	CLIP-seq
MIRT1331277	hsa-miR-4459	CLIP-seq
MIRT1331278	hsa-miR-4488	CLIP-seq
MIRT1331279	hsa-miR-4492	CLIP-seq
MIRT1331280	hsa-miR-4498	CLIP-seq
MIRT1331281	hsa-miR-449a	CLIP-seq
MIRT1331282	hsa-miR-449b	CLIP-seq
MIRT1331283	hsa-miR-449c	CLIP-seq
MIRT1331284	hsa-miR-4505	CLIP-seq
MIRT1331219	hsa-miR-451b	CLIP-seq
MIRT1331285	hsa-miR-4525	CLIP-seq
MIRT1331220	hsa-miR-4633-3p	CLIP-seq
MIRT1331222	hsa-miR-4647	CLIP-seq
MIRT1331286	hsa-miR-4655-3p	CLIP-seq
MIRT1331287	hsa-miR-4656	CLIP-seq
MIRT1331224	hsa-miR-4662b	CLIP-seq
MIRT1331288	hsa-miR-4675	CLIP-seq
MIRT1331289	hsa-miR-4697-5p	CLIP-seq
MIRT1331290	hsa-miR-4722-5p	CLIP-seq
MIRT1331291	hsa-miR-4731-5p	CLIP-seq
MIRT1331292	hsa-miR-4741	CLIP-seq
MIRT1331293	hsa-miR-4757-5p	CLIP-seq
MIRT1331231	hsa-miR-4777-3p	CLIP-seq
MIRT1331232	hsa-miR-4777-5p	CLIP-seq
MIRT1331294	hsa-miR-519a	CLIP-seq
MIRT1331295	hsa-miR-519b-3p	CLIP-seq
MIRT1331296	hsa-miR-519c-3p	CLIP-seq
MIRT1331238	hsa-miR-520a-3p	CLIP-seq
MIRT1331239	hsa-miR-520b	CLIP-seq
MIRT1331240	hsa-miR-520c-3p	CLIP-seq
MIRT1331241	hsa-miR-520d-3p	CLIP-seq
MIRT1331242	hsa-miR-520e	CLIP-seq
MIRT1331248	hsa-miR-624	CLIP-seq
MIRT1331297	hsa-miR-637	CLIP-seq
MIRT1331298	hsa-miR-762	CLIP-seq
MIRT1331253	hsa-miR-802	CLIP-seq
MIRT1331256	hsa-miR-934	CLIP-seq
MIRT2097903	hsa-miR-1179	CLIP-seq
MIRT2097904	hsa-miR-1229	CLIP-seq
MIRT1331177	hsa-miR-127-3p	CLIP-seq
MIRT2097905	hsa-miR-3150a-3p	CLIP-seq
MIRT2097906	hsa-miR-3175	CLIP-seq
MIRT2097907	hsa-miR-338-3p	CLIP-seq
MIRT2097908	hsa-miR-342-3p	CLIP-seq
MIRT1331206	hsa-miR-3918	CLIP-seq
MIRT2097909	hsa-miR-4310	CLIP-seq
MIRT2097910	hsa-miR-4667-5p	CLIP-seq
MIRT2097911	hsa-miR-4691-3p	CLIP-seq
MIRT2097912	hsa-miR-4700-5p	CLIP-seq
MIRT2097913	hsa-miR-520a-5p	CLIP-seq
MIRT2097914	hsa-miR-525-5p	CLIP-seq
MIRT2097915	hsa-miR-561	CLIP-seq
MIRT2097916	hsa-miR-602	CLIP-seq
MIRT2097917	hsa-miR-939	CLIP-seq
MIRT1331266	hsa-miR-298	CLIP-seq
MIRT1331191	hsa-miR-3148	CLIP-seq
MIRT1331206	hsa-miR-3918	CLIP-seq
MIRT2097918	hsa-miR-4645-5p	CLIP-seq
MIRT2097919	hsa-miR-4673	CLIP-seq
MIRT2097920	hsa-miR-4776-3p	CLIP-seq
MIRT2097913	hsa-miR-520a-5p	CLIP-seq
MIRT2097914	hsa-miR-525-5p	CLIP-seq
MIRT2097921	hsa-miR-766	CLIP-seq
MIRT2322492	hsa-miR-10a	CLIP-seq
MIRT2322493	hsa-miR-10b	CLIP-seq
MIRT2322494	hsa-miR-1183	CLIP-seq
MIRT2322495	hsa-miR-1193	CLIP-seq
MIRT2322496	hsa-miR-1207-5p	CLIP-seq
MIRT1331257	hsa-miR-1256	CLIP-seq
MIRT2322497	hsa-miR-1273d	CLIP-seq
MIRT2322498	hsa-miR-1273e	CLIP-seq
MIRT1331177	hsa-miR-127-3p	CLIP-seq
MIRT2322499	hsa-miR-1324	CLIP-seq
MIRT1331259	hsa-miR-133a	CLIP-seq
MIRT1331260	hsa-miR-133b	CLIP-seq
MIRT2322500	hsa-miR-1909	CLIP-seq
MIRT2322501	hsa-miR-191	CLIP-seq
MIRT1331262	hsa-miR-1913	CLIP-seq
MIRT1331180	hsa-miR-1915	CLIP-seq
MIRT1331263	hsa-miR-19a	CLIP-seq
MIRT1331264	hsa-miR-19b	CLIP-seq
MIRT1331181	hsa-miR-221	CLIP-seq
MIRT1331182	hsa-miR-222	CLIP-seq
MIRT2322502	hsa-miR-2355-5p	CLIP-seq
MIRT1331265	hsa-miR-2682	CLIP-seq
MIRT2322503	hsa-miR-27a	CLIP-seq
MIRT2322504	hsa-miR-27b	CLIP-seq
MIRT2322505	hsa-miR-28-5p	CLIP-seq
MIRT2322506	hsa-miR-2861	CLIP-seq
MIRT1331266	hsa-miR-298	CLIP-seq
MIRT1331183	hsa-miR-302a	CLIP-seq
MIRT1331184	hsa-miR-302b	CLIP-seq
MIRT1331185	hsa-miR-302c	CLIP-seq
MIRT1331186	hsa-miR-302d	CLIP-seq
MIRT1331187	hsa-miR-302e	CLIP-seq
MIRT1331267	hsa-miR-31	CLIP-seq
MIRT1331189	hsa-miR-3125	CLIP-seq
MIRT2322507	hsa-miR-3139	CLIP-seq
MIRT1331191	hsa-miR-3148	CLIP-seq
MIRT2322508	hsa-miR-3151	CLIP-seq
MIRT2322509	hsa-miR-3157-5p	CLIP-seq
MIRT2322510	hsa-miR-3176	CLIP-seq
MIRT1331269	hsa-miR-3194-3p	CLIP-seq
MIRT1331270	hsa-miR-324-3p	CLIP-seq
MIRT1331194	hsa-miR-330-3p	CLIP-seq
MIRT1331271	hsa-miR-34a	CLIP-seq
MIRT1331272	hsa-miR-34c-5p	CLIP-seq
MIRT2322511	hsa-miR-3607-5p	CLIP-seq
MIRT2322512	hsa-miR-3613-3p	CLIP-seq
MIRT2322513	hsa-miR-3622a-5p	CLIP-seq
MIRT2322514	hsa-miR-3679-3p	CLIP-seq
MIRT1331273	hsa-miR-3714	CLIP-seq
MIRT1331201	hsa-miR-372	CLIP-seq
MIRT1331202	hsa-miR-373	CLIP-seq
MIRT1331274	hsa-miR-377	CLIP-seq
MIRT1331205	hsa-miR-3916	CLIP-seq
MIRT1331206	hsa-miR-3918	CLIP-seq
MIRT1331207	hsa-miR-3919	CLIP-seq
MIRT2322515	hsa-miR-3922-3p	CLIP-seq
MIRT2322516	hsa-miR-3925-3p	CLIP-seq
MIRT2322517	hsa-miR-3944-5p	CLIP-seq
MIRT2322518	hsa-miR-3960	CLIP-seq
MIRT1331210	hsa-miR-3978	CLIP-seq
MIRT2322519	hsa-miR-4252	CLIP-seq
MIRT1331211	hsa-miR-4261	CLIP-seq
MIRT1331275	hsa-miR-4267	CLIP-seq
MIRT2322520	hsa-miR-4269	CLIP-seq
MIRT1331212	hsa-miR-4274	CLIP-seq
MIRT2322521	hsa-miR-4277	CLIP-seq
MIRT1331213	hsa-miR-4286	CLIP-seq
MIRT2322522	hsa-miR-4467	CLIP-seq
MIRT1331217	hsa-miR-4496	CLIP-seq
MIRT1331281	hsa-miR-449a	CLIP-seq
MIRT1331282	hsa-miR-449b	CLIP-seq
MIRT1331283	hsa-miR-449c	CLIP-seq
MIRT1331218	hsa-miR-4511	CLIP-seq
MIRT2322523	hsa-miR-4512	CLIP-seq
MIRT2322524	hsa-miR-4514	CLIP-seq
MIRT2322525	hsa-miR-4534	CLIP-seq
MIRT1331220	hsa-miR-4633-3p	CLIP-seq
MIRT2097918	hsa-miR-4645-5p	CLIP-seq
MIRT1331225	hsa-miR-4672	CLIP-seq
MIRT2097919	hsa-miR-4673	CLIP-seq
MIRT1331226	hsa-miR-4685-5p	CLIP-seq
MIRT2097911	hsa-miR-4691-3p	CLIP-seq
MIRT2322526	hsa-miR-4692	CLIP-seq
MIRT2322527	hsa-miR-4700-3p	CLIP-seq
MIRT2322528	hsa-miR-4736	CLIP-seq
MIRT2322529	hsa-miR-4758-3p	CLIP-seq
MIRT2322530	hsa-miR-4759	CLIP-seq
MIRT2322531	hsa-miR-4763-3p	CLIP-seq
MIRT1331231	hsa-miR-4777-3p	CLIP-seq
MIRT1331232	hsa-miR-4777-5p	CLIP-seq
MIRT2322532	hsa-miR-4790-3p	CLIP-seq
MIRT2322533	hsa-miR-4802-5p	CLIP-seq
MIRT2322534	hsa-miR-485-3p	CLIP-seq
MIRT2322535	hsa-miR-488	CLIP-seq
MIRT2322536	hsa-miR-490-3p	CLIP-seq
MIRT1331237	hsa-miR-494	CLIP-seq
MIRT2322537	hsa-miR-512-5p	CLIP-seq
MIRT2322538	hsa-miR-513a-5p	CLIP-seq
MIRT1331294	hsa-miR-519a	CLIP-seq
MIRT1331295	hsa-miR-519b-3p	CLIP-seq
MIRT1331296	hsa-miR-519c-3p	CLIP-seq
MIRT1331238	hsa-miR-520a-3p	CLIP-seq
MIRT2097913	hsa-miR-520a-5p	CLIP-seq
MIRT1331239	hsa-miR-520b	CLIP-seq
MIRT1331240	hsa-miR-520c-3p	CLIP-seq
MIRT1331241	hsa-miR-520d-3p	CLIP-seq
MIRT1331242	hsa-miR-520e	CLIP-seq
MIRT2097914	hsa-miR-525-5p	CLIP-seq
MIRT2322539	hsa-miR-548ac	CLIP-seq
MIRT2322540	hsa-miR-548d-3p	CLIP-seq
MIRT1331246	hsa-miR-548v	CLIP-seq
MIRT2322541	hsa-miR-548z	CLIP-seq
MIRT2322542	hsa-miR-583	CLIP-seq
MIRT2322543	hsa-miR-589	CLIP-seq
MIRT2322544	hsa-miR-610	CLIP-seq
MIRT1331248	hsa-miR-624	CLIP-seq
MIRT1331249	hsa-miR-626	CLIP-seq
MIRT2322545	hsa-miR-656	CLIP-seq
MIRT2322546	hsa-miR-660	CLIP-seq
MIRT2322547	hsa-miR-708	CLIP-seq
MIRT1331252	hsa-miR-759	CLIP-seq
MIRT2097921	hsa-miR-766	CLIP-seq
MIRT1331253	hsa-miR-802	CLIP-seq
MIRT1331254	hsa-miR-877	CLIP-seq
MIRT2394126	hsa-miR-1270	CLIP-seq
MIRT2394127	hsa-miR-4434	CLIP-seq
MIRT2394128	hsa-miR-4516	CLIP-seq
MIRT2394129	hsa-miR-4531	CLIP-seq
MIRT2394130	hsa-miR-620	CLIP-seq
MIRT2097909	hsa-miR-4310	CLIP-seq
MIRT2466008	hsa-miR-1184	CLIP-seq
MIRT2466009	hsa-miR-1205	CLIP-seq
MIRT2466010	hsa-miR-1268	CLIP-seq
MIRT2466011	hsa-miR-1268b	CLIP-seq
MIRT1331258	hsa-miR-1286	CLIP-seq
MIRT2466012	hsa-miR-3158-5p	CLIP-seq
MIRT1331277	hsa-miR-4459	CLIP-seq
MIRT2466013	hsa-miR-4527	CLIP-seq
MIRT1331290	hsa-miR-4722-5p	CLIP-seq
MIRT2618676	hsa-miR-339-3p	CLIP-seq
MIRT2322513	hsa-miR-3622a-5p	CLIP-seq
MIRT2322520	hsa-miR-4269	CLIP-seq
MIRT2618677	hsa-miR-515-5p	CLIP-seq
MIRT2618678	hsa-miR-885-3p	CLIP-seq
MIRT2618676	hsa-miR-339-3p	CLIP-seq
MIRT2322513	hsa-miR-3622a-5p	CLIP-seq
MIRT2322520	hsa-miR-4269	CLIP-seq

Show/Hide all (2)

Transcription factor	Regulation	Reference
NFKB1	Activation	16132527
RELA	Activation	16132527

Show/Hide all (22)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	15292202, 16982797, 18093920, 23395182, 32814053, 33961781
GO:0005576	Component	Extracellular region	IEA
GO:0005796	Component	Golgi lumen	TAS
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	2324102
GO:0006898	Process	Receptor-mediated endocytosis	IEA
GO:0009897	Component	External side of plasma membrane	IEA
GO:0009986	Component	Cell surface	IBA
GO:0009986	Component	Cell surface	IDA	25063885
GO:0009986	Component	Cell surface	IEA
GO:0016020	Component	Membrane	IEA
GO:0016477	Process	Cell migration	IBA
GO:0038024	Function	Cargo receptor activity	IEA
GO:0042802	Function	Identical protein binding	IPI	18093920
GO:0043202	Component	Lysosomal lumen	TAS
GO:0048627	Process	Myoblast development	IEA
GO:0048627	Process	Myoblast development	ISS
GO:0055002	Process	Striated muscle cell development	IEP	9566955
GO:0060070	Process	Canonical Wnt signaling pathway	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:1903543	Process	Positive regulation of exosomal secretion	IMP	22660413
GO:1903553	Process	Positive regulation of extracellular exosome assembly	IMP	22660413

MIM	HGNC	e!Ensembl
186355	10658	ENSG00000115884

P18827

Protein name

Syndecan-1 (SYND1) (CD antigen CD138)

Protein function

Cell surface proteoglycan that contains both heparan sulfate and chondroitin sulfate and that links the cytoskeleton to the interstitial matrix (By similarity). Regulates exosome biogenesis in concert with SDCBP and PDCD6IP (PubMed:22660413). Ab

PDB

4GVC , 4GVD , 6EJE

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01034	Syndecan	245 → 308	Syndecan domain	Family

Tissue specificity

TISSUE SPECIFICITY: Detected in placenta (at protein level) (PubMed:32337544). Detected in fibroblasts (at protein level) (PubMed:36213313). {ECO:0000269|PubMed:32337544, ECO:0000269|PubMed:36213313}.

Sequence

MRRAALWLWLCALALSLQPALPQIVATNLPPEDQDGSGDDSDNFSGSGAGALQDITLSQQ
TPSTWKDTQLLTAIPTSPEPTGLEATAASTSTLPAGEGPKEGEAVVLPEVEPGLTAREQE
ATPRPRETTQLPTTHLASTTTATTAQEPATSHPHRDMQPGHHETSTPAGPSQADLHTPHT
EDGGPSATERAAEDGASSQLPAAEGSGEQDFTFETSGENTAVVAVEPDRRNQSPVDQGAT
GASQGLLDRKEVLGGVIAGGLVGLIFAVCLVGFMLYRMKKKDEGSYSLEEPKQANGGAYQ
KPTKQEEFYA

Sequence length

310

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ANDROGENETIC ALOPECIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Long QT syndrome	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MESOTHELIOMA, MALIGNANT	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, KNEE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (325)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma	Adenocarcinoma	BEFREE	11743640, 14562280, 18006945, 23780687, 24549646, 25017879, 31417929		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	26627455		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Clear Cell	Adenocarcinoma	BEFREE	26526579		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoid Cystic Carcinoma	Adenocarcinoma	BEFREE	18378436		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	18925696, 22994707		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	BEFREE	23988031, 26293675		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	23728345		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	30718543	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ameloblastoma	Ameloblastoma	Pubtator	25690860, 28390135, 29850393, 33917771, 38504068	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ameloblastoma	Ameloblastoma	BEFREE	28390135, 29850393		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ameloblastoma	Ameloblastoma	Pubtator	30151060	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	19135901, 22100494, 28454452		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	Pubtator	19135901	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyloidosis cutis dyschromia	Amyloidosis Cutis Dyschromia	BEFREE	24283919		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	14562280		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aneuploidy	Aneuploidy	Pubtator	26608463	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	30918400		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Thoracoabdominal	Aortic Aneurysm	BEFREE	28659919		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Valve Stenosis	Aortic Valve Sclerosis	BEFREE	29248646		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	25550207		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	17545191	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	17040961	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	25550207		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	36524421	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	36078037	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	28045014		★★★★★ ★☆☆☆☆ Found in Text Mining only
Avellino corneal dystrophy	Avellino Corneal Dystrophy	BEFREE	24283919		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	11014588, 16323006, 17651861, 20093236, 28608720, 31783811, 9746758		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	LHGDN	16778379		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-CELL MALIGNANCY, LOW-GRADE	Lymphocytic Leukemia	BEFREE	9470818		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bile Duct Neoplasms	Bile duct neoplasms	Pubtator	19420730	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	19860843, 24524203		★★★★★ ★☆☆☆☆ Found in Text Mining only
Blood Coagulation Disorders	Blood Coagulation Disorders	BEFREE	29261771		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone Disease	BEFREE	22082361		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone disease	Pubtator	34884950	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Marrow Diseases	Bone marrow diseases	Pubtator	9136941	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	11454708, 12879463, 15383330, 17344212, 17347152, 18542065, 18729497, 19126645, 21224069, 22573479, 23289672, 24083474, 24392029, 25361632, 28382590 View all (13 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	11454708, 12879463, 15479743, 16739330, 17244359, 17970043, 18729497, 19010933, 20132413, 20460509, 21430259, 23289672, 24392029, 25273930, 25361632 View all (18 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	28399903, 38189813	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	16216037		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cancer Pain	Cancer	Pubtator	21356373	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	15800679, 24392029, 25589885, 26526579, 26972718	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	11676857, 15383330, 17413980, 18542065, 19860843, 24150912, 26526579, 28351285, 28744948, 31424668		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	Pubtator	26852939	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Adenoid Cystic	Adenoid cystic carcinoma	Pubtator	31540870	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	26456960	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal	Ductal carcinoma	Pubtator	16739330	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal	Ductal carcinoma	Pubtator	24373193, 30151336	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal Breast	Ductal carcinoma of breast	Pubtator	17244359, 18542065, 24373193, 25273930, 35587107	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	10507762, 15770719, 27556509, 30826971, 32977498	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	17244359, 35587107	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Merkel Cell	Merkel cell carcinoma	Pubtator	34896889	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Mucoepidermoid	Mucoepidermoid carcinoma	Pubtator	31540870	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Mucoepidermoid	Mucoepidermoid carcinoma	Pubtator	36012301	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	15177497, 19860843, 24524203		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	11786733, 29355516		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	27048364	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	37907515	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	26526579	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	31976021	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	8054282	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	31443604		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	30578753		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Cartilage disease	Pubtator	27082728	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	BEFREE	25198673, 28025744		★★★★★ ★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	Pubtator	37455655	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	11743640, 18006945		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	11743640, 18006945, 9935152		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	23728345		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	22872444		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	35672673	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholestasis Extrahepatic	Cholelithiasis	Pubtator	19420730	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	BEFREE	31417929		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chromophobe Renal Cell Carcinoma	Chromophobe Carcinoma	BEFREE	30467700		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	30550765		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	LHGDN	16840194		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	18190591, 20013319, 9470818		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Pain	Chronic pain	Pubtator	31649376	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	Pubtator	31050915	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Citrullinemia	Citrullinemia	Pubtator	35612662	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	20008145, 21987406, 24150912, 25970544, 27558380		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	15177497, 25589885, 25715761, 28350804		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	18590537	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	19253033	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	11676858, 20193112, 25321193, 25589885, 31182980, 31783811		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	11676858, 12055189, 20193112, 25589885, 36730554, 36800011	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	16020957		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	20193112, 28350804		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	31182980, 31783811	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	31976021	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common Variable Immunodeficiency	BEFREE	19738033		★★★★★ ★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common variable immunodeficiency	Pubtator	32575504	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	23012246		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital thrombotic disease due to Protein C deficiency	Congenital thrombotic thrombocytopenic purpura	Pubtator	18553158, 26666746	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	30578753		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cortical cataract	Cortical cataract	BEFREE	29438221		★★★★★ ★☆☆☆☆ Found in Text Mining only
Craniosynostosis	Craniosynostosis	BEFREE	28958373		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	23511033, 24283919		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	25267953	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystitis Interstitial	Interstitial cystitis	Pubtator	18082196	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	11592366, 23546957, 27082728		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive Disorder Major	Major depressive disorder	Pubtator	17660861	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	30045969		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic 1	Atopic dermatitis	Pubtator	12452825	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis, Allergic Contact	Dermatitis	BEFREE	24150912		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	35079788	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	24150912, 29162604		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	26720478		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	11106080, 12378521, 15816558, 16216037, 18925696, 22994707		★★★★★ ★☆☆☆☆ Found in Text Mining only
Disseminated Intravascular Coagulation	Disseminated Intravascular Coagulation	BEFREE	28843664		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ductal Breast Carcinoma	Breast Carcinoma	BEFREE	30061226, 30151336		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ductal Carcinoma	Ductal Carcinoma	BEFREE	30151336		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	BEFREE	30550765		★★★★★ ★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	BEFREE	31156383		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	19539355		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	15851381, 31898658	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial Neoplasms	LHGDN	17455248		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	23206733		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	23206733	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	31443604		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelioma	Epithelioma	BEFREE	25912030		★★★★★ ★☆☆☆☆ Found in Text Mining only
Erectile dysfunction	Erectile Dysfunction	BEFREE	29936329		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	11676857	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	20430722	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrolamellar Hepatocellular Carcinoma	Hepatocellular Carcinoma	BEFREE	22872444		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	BEFREE	29216821		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	31115505		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	28351285		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	32812461	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastric ulcer	Gastric ulcer	BEFREE	10398089		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	30497369, 37441590, 40052499	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	29322326, 30679164		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	LHGDN	16132527		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	22714920, 28422726, 29322326, 29344156, 30679164, 31614325		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	22906261, 28422726, 40495644	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hamartoma Syndrome, Multiple	Hamartoma	BEFREE	29438221		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	10027330		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	10027330, 11676857, 8054282	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	23139380	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	30578753		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	26293675, 31186046		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	34337077	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis Autoimmune	Autoimmune hepatitis	Pubtator	36973120	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	23988031, 26293675, 9746758		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	23988031, 9160685, 9746758	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington disease	Pubtator	10090942	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperplasia	Hyperplasia	Pubtator	31898658	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	29513563		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	24126540, 26729247	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	26878134	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	19073610		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	BEFREE	22215754		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	17536013		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inclusion Body Myositis (disorder)	Inclusion Body Myositis	BEFREE	16344523, 17182595		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	21987406, 25970544		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Breast Carcinoma	Breast Cancer	BEFREE	28270211, 31145753		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory dermatosis	Dermatitis	BEFREE	30045969		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal disease	Pubtator	15902740	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal disease	Pubtator	16773719	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	14562280		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	30278359		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	11014588, 9389706		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	28264449, 31535918	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	29340529		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure	Kidney Failure	BEFREE	22237752		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	31882513	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	29557914, 29940146, 31512003		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	21630196	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leiomyosarcoma of uterus	Leiomyosarcoma Of Uterus	BEFREE	29844831		★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	11122145, 15772984		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	34337077	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	24762495, 29484435		★★★★★ ★☆☆☆☆ Found in Text Mining only
liposarcoma	Liposarcoma	BEFREE	25344834		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liposarcoma, Dedifferentiated	liposarcoma	BEFREE	25344834		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	10507762, 18773447, 28209511, 29180036, 30297672, 30826971		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	15770719		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	29454902		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	33402482	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	30826971, 33402482	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	11676858	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	30826971	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure, Acute	Liver failure	BEFREE	29321049		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	31976021	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	11786733, 23374247	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	15645424		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	11067960, 21961021, 39867907	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	21320038	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	11067960, 21320038, 27838471, 28045014		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	15851381, 31182980	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	18395897, 18590537, 20193112, 36012301	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	BEFREE	28209511		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	10027728, 9389706		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	10027728, 10050727, 11006575, 20614267, 26878134	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	BEFREE	11106080, 19838161		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative syndrome	Pubtator	12429820, 12907442, 23551167	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative Disorder	BEFREE	21509436, 31791993		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	16132527		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant lymphoma, lymphocytic, intermediate differentiation, diffuse	Malignant lymphoma, lymphocytic, intermediate differentiation	BEFREE	31791993		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	CTD_human_DG	27032653		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Mesothelioma of Peritoneum	Peritoneal mesothelioma	BEFREE	29048219		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	11454708, 17344212, 17347152, 18729497, 19126645, 21224069, 22573479, 23289672, 24083474, 24392029, 25361632, 28382590, 29340066, 29666962, 29963269 View all (8 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	19539355		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	10962434		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	10962434		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	11786733, 29355516		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	29484435		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	17413980		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	10962434, 26627455, 29956739, 30918400		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	14972511, 20927321, 24424718, 24549646, 26259043, 28744948, 29628317, 30065348		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	BEFREE	20082322		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	18751407		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	19860843, 24524203		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10962434, 11676857, 11676858, 11743640, 14562280, 15177497, 16210338, 17028596, 17536013, 18542065, 19539355, 19596856, 19840029, 19860843, 22573479 View all (34 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	11743640, 18006945		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	25589885, 25715761		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	14744776, 15459490, 15743035, 18413760		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	25361632, 28382590, 29976229		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	31791993		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	23728345		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	19696445, 20803552, 24722758	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	23352437, 24722758, 28977882		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	23144729, 29048219		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	Pubtator	23144729, 32664515	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	23144729, 26210886, 32664515, 36523602	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metastatic Prostate Carcinoma	Metastatic Prostate Carcinoma	BEFREE	14972511		★★★★★ ★☆☆☆☆ Found in Text Mining only
Monoclonal Gammopathy of Undetermined Significance	Monoclonal Gammapathies	BEFREE	11861292, 17077331, 18728182, 20096010, 20736376, 21592325, 23408834, 25353275, 26433312, 27140172		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth Neoplasms	LHGDN	19020713		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	24762495	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	BEFREE	29601451, 31200965		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	Pubtator	31159728	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	10027726, 10050721, 10050727, 10848782, 11830493, 11877746, 11985351, 12101201, 12200383, 12609839, 12911939, 12969976, 14576062, 14615378, 15274361 View all (81 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	11830493, 11861292, 12091355, 12393520, 12804633, 14559802, 14615378, 14630803, 15087402, 15205949, 15388584, 15561686, 16208410, 16210338, 16278310 View all (108 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	LHGDN	11830493		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	29151530	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	29798960	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	15210828, 17947712, 28777826, 29708072		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	32398079	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis, Relapsing-Remitting	Multiple Sclerosis	BEFREE	30244922		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	30278359		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	Pubtator	35612662	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	20047808, 23473835, 28958373		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	16949936		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10027330, 10962434, 11454708, 11676858, 11743640, 11830493, 12091355, 12879463, 14562280, 14695190, 14744776, 15177497, 15363033, 15645424, 15735016 View all (67 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephritis, Interstitial	Nephritis	BEFREE	28794148		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephritis, Tubulointerstitial	Nephritis	BEFREE	28794148		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic Syndrome	BEFREE	30384404		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	27448979	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	8622876		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	30480372		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurofibromatosis Familial Spinal	Neurofibromatosis	Pubtator	37217626	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuromyelitis Optica	Neuromyelitis Optica	BEFREE	30142535		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nodular Sclerosis Classical Hodgkin Lymphoma	Classical Hodgkin lymphoma	BEFREE	23988031		★★★★★ ★☆☆☆☆ Found in Text Mining only
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	BEFREE	17244359, 29141852		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	11461706		★★★★★ ★☆☆☆☆ Found in Text Mining only
Odontogenic Tumors	Odontogenic Tumor	BEFREE	29480622		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oncocytoma, renal	Oncocytoma of kidney	BEFREE	30467700		★★★★★ ★☆☆☆☆ Found in Text Mining only
Optic Neuritis	Optic Neuritis	BEFREE	15236406		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	10607497, 23546957, 32832544	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	10375199		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	15297422		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	26191180, 26526579, 27048364, 35047055	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	10962434, 26627455, 29956739, 30918400		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	10962434, 26627455		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	LHGDN	15886501		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	31412643, 31976021, 38048216	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	31584877	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis, Chronic	Pancreatitis	BEFREE	10962434		★★★★★ ★☆☆☆☆ Found in Text Mining only
Papilloma	Papilloma	BEFREE	20082322		★★★★★ ★☆☆☆☆ Found in Text Mining only
Perforation of colon	Perforation Of Colon	BEFREE	31610336		★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	35888586	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pilomatrixoma	Pilomatrixoma	BEFREE	21048491		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polymyositis	Polymyositis	BEFREE	16344523, 17182595		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary amyloidosis	Amyloidosis	BEFREE	15388584		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary Ciliary Dyskinesia	Ciliary dyskinesia	BEFREE	23969274		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary sclerosing cholangitis	Sclerosing Cholangitis	BEFREE	27784538		★★★★★ ★☆☆☆☆ Found in Text Mining only
Proliferative diabetic retinopathy	Proliferative Diabetic Retinopathy	BEFREE	26720478		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	14972511, 20927321, 24424718, 24549646, 26259043, 28744948, 29628317, 30065348		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	14972511		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	21317913, 23066085, 28744948, 30065348, 32124938, 33195694, 33995654, 34445387, 36089417, 37596305	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	28744948		★★★★★ ★☆☆☆☆ Found in Text Mining only
Proteinuria	Proteinuria	Pubtator	18032547	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasiform eczema	Psoriasiform eczema	BEFREE	30045969		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	18386024		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	LHGDN	18386024		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	31695352	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	19073610, 31393853		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	BEFREE	28260391, 28264449		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Failure	Respiratory Failure	BEFREE	29936329		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	11592366, 29720240, 29848137		★★★★★ ★☆☆☆☆ Found in Text Mining only
Salivary Gland Neoplasms	Salivary gland neoplasm	BEFREE	31540870		★★★★★ ★☆☆☆☆ Found in Text Mining only
Salivary Gland Neoplasms	Salivary gland neoplasms	Pubtator	31540870, 36012301	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Selective immunoglobulin A deficiency	Selective Immunoglobulin A Deficiency	BEFREE	19738033		★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	28822340, 28843664, 28986821, 29318186, 29327601, 29936329, 30243993		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	31661985	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	20082322		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin Neoplasms	BEFREE	20082322		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spondylitis Ankylosing	Ankylosing spondylitis	Pubtator	36524421	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	10027330, 11676857, 11743640, 16280239, 18006945, 20082322, 23278563, 23545927, 23553620		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	18006945		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	10027330, 20237901, 26057450, 36510963	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of skin	Skin carcinoma	BEFREE	23278563		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	26323460		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of tongue	Tongue carcinoma	BEFREE	16280239		★★★★★ ★☆☆☆☆ Found in Text Mining only
ST segment elevation myocardial infarction	ST Segment Elevation Myocardial Infarction	BEFREE	29438221, 31797997		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	18751407		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	15902740		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	15902740, 18395897	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	18751407, 31424668	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	29669578		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombophilia	Thrombophilia	BEFREE	27779595		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	30614796	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	LHGDN	17431390		★★★★★ ★☆☆☆☆ Found in Text Mining only
Transitional cell carcinoma of bladder	Bladder carcinoma	BEFREE	19860843		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	24392029, 29666962		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	24392029, 28270211	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	20008145, 27558380, 29464806		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	19822079, 24524203, 25387487, 36131343	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	33721374	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urothelial Carcinoma	Urothelial Carcinoma	BEFREE	19860843		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	36768853	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	32388727, 35098380	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	34638892	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Waldenstrom Macroglobulinemia	Waldenstrom macroglobulinemia	Pubtator	22949945	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Waldenstrom Macroglobulinemia	Waldenstrom`s Macroglobulinemia	BEFREE	23477935, 26878134, 30227405		★★★★★ ★☆☆☆☆ Found in Text Mining only
Waldenstrom Macroglobulinemia	Waldenstrom macroglobulinemia	Pubtator	24189269, 33634586	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

SDC1 (syndecan 1)