Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	642658
Gene name	Scleraxis bHLH transcription factor
Gene symbol	SCX
Synonyms (NCBI Gene)	SCXASCXBbHLHa48
Chromosome	8
Chromosome location	8q24.3

86 Show/Hide all (86)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0000987	Function	Cis-regulatory region sequence-specific DNA binding	IEA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	10775504
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA
GO:0001707	Process	Mesoderm formation	IEA
GO:0001707	Process	Mesoderm formation	ISS
GO:0001894	Process	Tissue homeostasis	IEA
GO:0001894	Process	Tissue homeostasis	ISS
GO:0001958	Process	Endochondral ossification	IEA
GO:0001958	Process	Endochondral ossification	ISS
GO:0002062	Process	Chondrocyte differentiation	IEA
GO:0002062	Process	Chondrocyte differentiation	ISS
GO:0003179	Process	Heart valve morphogenesis	IEA
GO:0003179	Process	Heart valve morphogenesis	ISS
GO:0003188	Process	Heart valve formation	IEA
GO:0003188	Process	Heart valve formation	ISS
GO:0003677	Function	DNA binding	IEA
GO:0003677	Function	DNA binding	ISS
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005634	Component	Nucleus	IDA	10775504, 19828133
GO:0005634	Component	Nucleus	IEA
GO:0005667	Component	Transcription regulator complex	IDA	10775504
GO:0005667	Component	Transcription regulator complex	IEA
GO:0006351	Process	DNA-templated transcription	IEA
GO:0006351	Process	DNA-templated transcription	ISS
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	ISS
GO:0010628	Process	Positive regulation of gene expression	IEA
GO:0010628	Process	Positive regulation of gene expression	ISS
GO:0010629	Process	Negative regulation of gene expression	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0030154	Process	Cell differentiation	ISS
GO:0030199	Process	Collagen fibril organization	IEA
GO:0030199	Process	Collagen fibril organization	ISS
GO:0030509	Process	BMP signaling pathway	IEA
GO:0030509	Process	BMP signaling pathway	ISS
GO:0032502	Process	Developmental process	IBA
GO:0032967	Process	Positive regulation of collagen biosynthetic process	IEA
GO:0032967	Process	Positive regulation of collagen biosynthetic process	ISS
GO:0035914	Process	Skeletal muscle cell differentiation	IEA
GO:0035989	Process	Tendon development	IEA
GO:0035989	Process	Tendon development	ISS
GO:0035990	Process	Tendon cell differentiation	IEA
GO:0035990	Process	Tendon cell differentiation	ISS
GO:0035992	Process	Tendon formation	IEA
GO:0035992	Process	Tendon formation	ISS
GO:0035993	Process	Deltoid tuberosity development	IEA
GO:0035993	Process	Deltoid tuberosity development	ISS
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0043066	Process	Negative regulation of apoptotic process	ISS
GO:0043425	Function	BHLH transcription factor binding	IEA
GO:0043425	Function	BHLH transcription factor binding	IPI	10775504
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0043565	Function	Sequence-specific DNA binding	ISS
GO:0045892	Process	Negative regulation of DNA-templated transcription	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	ISS
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	10775504
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	ISS
GO:0046983	Function	Protein dimerization activity	IEA
GO:0048706	Process	Embryonic skeletal system development	IEA
GO:0060008	Process	Sertoli cell differentiation	IEA
GO:0060008	Process	Sertoli cell differentiation	ISS
GO:0060009	Process	Sertoli cell development	IEA
GO:0060325	Process	Face morphogenesis	IEA
GO:0061035	Process	Regulation of cartilage development	IEA
GO:0061035	Process	Regulation of cartilage development	ISS
GO:0061036	Process	Positive regulation of cartilage development	IEA
GO:0061036	Process	Positive regulation of cartilage development	ISS
GO:0061056	Process	Sclerotome development	IEA
GO:0070888	Function	E-box binding	IDA	10775504
GO:0070888	Function	E-box binding	IEA
GO:0071260	Process	Cellular response to mechanical stimulus	IEA
GO:0071320	Process	Cellular response to cAMP	IEA
GO:0071372	Process	Cellular response to follicle-stimulating hormone stimulus	IEA
GO:0071560	Process	Cellular response to transforming growth factor beta stimulus	IEA
GO:0071773	Process	Cellular response to BMP stimulus	IEA
GO:2000543	Process	Positive regulation of gastrulation	IEA
GO:2000543	Process	Positive regulation of gastrulation	ISS

MIM	HGNC	e!Ensembl
609067	32322	ENSG00000260428

Q7RTU7

Protein name

Basic helix-loop-helix transcription factor scleraxis (Class A basic helix-loop-helix protein 41) (bHLHa41) (Class A basic helix-loop-helix protein 48) (bHLHa48)

Protein function

Plays an early essential role in mesoderm formation, as well as a later role in formation of somite-derived chondrogenic lineages.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00010	HLH	76 → 128	Helix-loop-helix DNA-binding domain	Domain

Sequence

MSFATLRPAPPGRYLYPEVSPLSEDEDRGSDSSGSDEKPCRVHAARCGLQGARRRAGGRR
AGGGGPGGRPGREPRQRHTANARERDRTNSVNTAFTALRTLIPTEPADRKLSKIETLRLA
SSYISHLGNVLLAGEACGDGQPCHSGPAFFHAARAGSPPPPPPPPPARDGENTQPKQICT
FCLSNQRKLSKDRDRKTAIRS

Sequence length

201

Interactions

View interactions

Related Genes Genes most often co-reported with SCX across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for SCX.

Diseases Linked via Similar Genes Diseases curated for genes most similar to SCX (see Related Genes above), that are NOT already directly curated for SCX itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to SCX.

SCX (scleraxis bHLH transcription factor)

Bookmark This Gene