Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Other IDs Associated diseases
Entrez ID	6330
Gene name	Sodium voltage-gated channel beta subunit 4
Gene symbol	SCN4B
Synonyms (NCBI Gene)	ATFB17LQT10Navbeta4
Chromosome	11
Chromosome location	11q23.3
Summary	The protein encoded by this gene is one of several sodium channel beta subunits. These subunits interact with voltage-gated alpha subunits to change sodium channel kinetics. The encoded transmembrane protein forms interchain disulfide bonds with SCN2A. De

Show/Hide all (6)

SNP ID	Visualize variation	Clinical significance	Consequence
rs112363898	T>A	Uncertain-significance, likely-benign, conflicting-interpretations-of-pathogenicity	Non coding transcript variant, 5 prime UTR variant, coding sequence variant, missense variant, intron variant
rs121434386	G>A	Pathogenic	Coding sequence variant, non coding transcript variant, missense variant
rs149868494	C>T	Likely-benign, conflicting-interpretations-of-pathogenicity	Missense variant, genic upstream transcript variant, coding sequence variant
rs587777559	A>C	Pathogenic	Coding sequence variant, missense variant, non coding transcript variant
rs587777560	T>G	Pathogenic	Coding sequence variant, missense variant, non coding transcript variant
rs777894412	C>G,T	Conflicting-interpretations-of-pathogenicity	Missense variant, intron variant, non coding transcript variant, coding sequence variant, 5 prime UTR variant

160

Show/Hide all (160)

miRTarBase ID	miRNA	Experiments	Reference
MIRT023310	hsa-miR-122-5p	Microarray	17612493
MIRT1330109	hsa-let-7a	CLIP-seq
MIRT1330110	hsa-let-7b	CLIP-seq
MIRT1330111	hsa-let-7c	CLIP-seq
MIRT1330112	hsa-let-7d	CLIP-seq
MIRT1330113	hsa-let-7e	CLIP-seq
MIRT1330114	hsa-let-7f	CLIP-seq
MIRT1330115	hsa-let-7g	CLIP-seq
MIRT1330116	hsa-let-7i	CLIP-seq
MIRT1330117	hsa-miR-1207-3p	CLIP-seq
MIRT1330118	hsa-miR-1252	CLIP-seq
MIRT1330119	hsa-miR-1273f	CLIP-seq
MIRT1330120	hsa-miR-1294	CLIP-seq
MIRT1330121	hsa-miR-132	CLIP-seq
MIRT1330122	hsa-miR-1321	CLIP-seq
MIRT1330123	hsa-miR-143	CLIP-seq
MIRT1330124	hsa-miR-15a	CLIP-seq
MIRT1330125	hsa-miR-15b	CLIP-seq
MIRT1330126	hsa-miR-16	CLIP-seq
MIRT1330127	hsa-miR-1909	CLIP-seq
MIRT1330128	hsa-miR-1910	CLIP-seq
MIRT1330129	hsa-miR-1913	CLIP-seq
MIRT1330130	hsa-miR-1914	CLIP-seq
MIRT1330131	hsa-miR-1915	CLIP-seq
MIRT1330132	hsa-miR-193a-3p	CLIP-seq
MIRT1330133	hsa-miR-193b	CLIP-seq
MIRT1330134	hsa-miR-195	CLIP-seq
MIRT1330135	hsa-miR-202	CLIP-seq
MIRT1330136	hsa-miR-2110	CLIP-seq
MIRT1330137	hsa-miR-212	CLIP-seq
MIRT1330138	hsa-miR-3117-5p	CLIP-seq
MIRT1330139	hsa-miR-3150a-3p	CLIP-seq
MIRT1330140	hsa-miR-3153	CLIP-seq
MIRT1330141	hsa-miR-3162-3p	CLIP-seq
MIRT1330142	hsa-miR-3162-5p	CLIP-seq
MIRT739050	hsa-miR-3188	CLIP-seq
MIRT1330143	hsa-miR-324-3p	CLIP-seq
MIRT1330144	hsa-miR-3614-5p	CLIP-seq
MIRT1330145	hsa-miR-3620	CLIP-seq
MIRT1330146	hsa-miR-3646	CLIP-seq
MIRT1330147	hsa-miR-3944-5p	CLIP-seq
MIRT1330148	hsa-miR-424	CLIP-seq
MIRT1330149	hsa-miR-4265	CLIP-seq
MIRT1330150	hsa-miR-4268	CLIP-seq
MIRT1330151	hsa-miR-4271	CLIP-seq
MIRT1330152	hsa-miR-4287	CLIP-seq
MIRT1330153	hsa-miR-4296	CLIP-seq
MIRT1330154	hsa-miR-4312	CLIP-seq
MIRT1330155	hsa-miR-4316	CLIP-seq
MIRT1330156	hsa-miR-4318	CLIP-seq
MIRT1330157	hsa-miR-4322	CLIP-seq
MIRT1330158	hsa-miR-4417	CLIP-seq
MIRT1330159	hsa-miR-4434	CLIP-seq
MIRT1330160	hsa-miR-4436a	CLIP-seq
MIRT1330161	hsa-miR-4436b-5p	CLIP-seq
MIRT1330162	hsa-miR-4446-3p	CLIP-seq
MIRT739049	hsa-miR-4446-5p	CLIP-seq
MIRT1330163	hsa-miR-4448	CLIP-seq
MIRT1330164	hsa-miR-4458	CLIP-seq
MIRT1330165	hsa-miR-4468	CLIP-seq
MIRT1330166	hsa-miR-4469	CLIP-seq
MIRT1330167	hsa-miR-4475	CLIP-seq
MIRT1330168	hsa-miR-4492	CLIP-seq
MIRT1330169	hsa-miR-4498	CLIP-seq
MIRT1330170	hsa-miR-4499	CLIP-seq
MIRT1330171	hsa-miR-4500	CLIP-seq
MIRT1330172	hsa-miR-4503	CLIP-seq
MIRT1330173	hsa-miR-4504	CLIP-seq
MIRT1330174	hsa-miR-4505	CLIP-seq
MIRT1330175	hsa-miR-4516	CLIP-seq
MIRT1330176	hsa-miR-4522	CLIP-seq
MIRT1330177	hsa-miR-4641	CLIP-seq
MIRT1330178	hsa-miR-4646-5p	CLIP-seq
MIRT1330179	hsa-miR-4662a-3p	CLIP-seq
MIRT1330180	hsa-miR-4668-5p	CLIP-seq
MIRT1330181	hsa-miR-4677-3p	CLIP-seq
MIRT1330182	hsa-miR-4679	CLIP-seq
MIRT1330183	hsa-miR-4685-3p	CLIP-seq
MIRT1330184	hsa-miR-4685-5p	CLIP-seq
MIRT1330185	hsa-miR-4691-3p	CLIP-seq
MIRT1330186	hsa-miR-4701-5p	CLIP-seq
MIRT1330187	hsa-miR-4708-5p	CLIP-seq
MIRT1330188	hsa-miR-4709-5p	CLIP-seq
MIRT1330189	hsa-miR-4711-5p	CLIP-seq
MIRT1330190	hsa-miR-4713-5p	CLIP-seq
MIRT1330191	hsa-miR-4725-3p	CLIP-seq
MIRT1330192	hsa-miR-4739	CLIP-seq
MIRT739048	hsa-miR-4755-5p	CLIP-seq
MIRT1330193	hsa-miR-4756-5p	CLIP-seq
MIRT1330194	hsa-miR-4770	CLIP-seq
MIRT1330195	hsa-miR-497	CLIP-seq
MIRT1330196	hsa-miR-542-3p	CLIP-seq
MIRT1330197	hsa-miR-548a-3p	CLIP-seq
MIRT1330198	hsa-miR-548e	CLIP-seq
MIRT1330199	hsa-miR-548f	CLIP-seq
MIRT1330200	hsa-miR-548g	CLIP-seq
MIRT1330201	hsa-miR-588	CLIP-seq
MIRT1330202	hsa-miR-646	CLIP-seq
MIRT739047	hsa-miR-670	CLIP-seq
MIRT1330203	hsa-miR-762	CLIP-seq
MIRT1330204	hsa-miR-922	CLIP-seq
MIRT1330205	hsa-miR-98	CLIP-seq
MIRT739050	hsa-miR-3188	CLIP-seq
MIRT739049	hsa-miR-4446-5p	CLIP-seq
MIRT739048	hsa-miR-4755-5p	CLIP-seq
MIRT739047	hsa-miR-670	CLIP-seq
MIRT739050	hsa-miR-3188	CLIP-seq
MIRT739049	hsa-miR-4446-5p	CLIP-seq
MIRT739048	hsa-miR-4755-5p	CLIP-seq
MIRT739047	hsa-miR-670	CLIP-seq
MIRT739050	hsa-miR-3188	CLIP-seq
MIRT739049	hsa-miR-4446-5p	CLIP-seq
MIRT739048	hsa-miR-4755-5p	CLIP-seq
MIRT739047	hsa-miR-670	CLIP-seq
MIRT739050	hsa-miR-3188	CLIP-seq
MIRT739049	hsa-miR-4446-5p	CLIP-seq
MIRT739048	hsa-miR-4755-5p	CLIP-seq
MIRT739047	hsa-miR-670	CLIP-seq
MIRT739050	hsa-miR-3188	CLIP-seq
MIRT739049	hsa-miR-4446-5p	CLIP-seq
MIRT739048	hsa-miR-4755-5p	CLIP-seq
MIRT739047	hsa-miR-670	CLIP-seq
MIRT739050	hsa-miR-3188	CLIP-seq
MIRT739049	hsa-miR-4446-5p	CLIP-seq
MIRT739048	hsa-miR-4755-5p	CLIP-seq
MIRT739047	hsa-miR-670	CLIP-seq
MIRT2097805	hsa-miR-1233	CLIP-seq
MIRT2097806	hsa-miR-1273d	CLIP-seq
MIRT2097807	hsa-miR-3120-5p	CLIP-seq
MIRT739050	hsa-miR-3188	CLIP-seq
MIRT2097808	hsa-miR-346	CLIP-seq
MIRT2097809	hsa-miR-3663-5p	CLIP-seq
MIRT2097810	hsa-miR-4288	CLIP-seq
MIRT2097811	hsa-miR-4308	CLIP-seq
MIRT739049	hsa-miR-4446-5p	CLIP-seq
MIRT2097812	hsa-miR-4447	CLIP-seq
MIRT2097813	hsa-miR-4472	CLIP-seq
MIRT2097814	hsa-miR-4527	CLIP-seq
MIRT2097815	hsa-miR-4723-5p	CLIP-seq
MIRT739048	hsa-miR-4755-5p	CLIP-seq
MIRT2097816	hsa-miR-4797-3p	CLIP-seq
MIRT2097817	hsa-miR-632	CLIP-seq
MIRT739047	hsa-miR-670	CLIP-seq
MIRT2097818	hsa-miR-767-3p	CLIP-seq
MIRT2097819	hsa-miR-939	CLIP-seq
MIRT2322112	hsa-miR-1202	CLIP-seq
MIRT2322113	hsa-miR-3184	CLIP-seq
MIRT2322114	hsa-miR-3194-5p	CLIP-seq
MIRT2322115	hsa-miR-3926	CLIP-seq
MIRT2322116	hsa-miR-3972	CLIP-seq
MIRT2322117	hsa-miR-423-5p	CLIP-seq
MIRT1330149	hsa-miR-4265	CLIP-seq
MIRT1330153	hsa-miR-4296	CLIP-seq
MIRT1330157	hsa-miR-4322	CLIP-seq
MIRT1330158	hsa-miR-4417	CLIP-seq
MIRT2322118	hsa-miR-4728-5p	CLIP-seq
MIRT2322119	hsa-miR-548s	CLIP-seq
MIRT739047	hsa-miR-670	CLIP-seq
MIRT739049	hsa-miR-4446-5p	CLIP-seq
MIRT2432935	hsa-miR-4740-3p	CLIP-seq

Show/Hide all (35)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001518	Component	Voltage-gated sodium channel complex	IBA
GO:0001518	Component	Voltage-gated sodium channel complex	IDA	12930796, 17592081
GO:0001518	Component	Voltage-gated sodium channel complex	IMP	24297919
GO:0005248	Function	Voltage-gated sodium channel activity	IDA	12930796
GO:0005248	Function	Voltage-gated sodium channel activity	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	24297919
GO:0005886	Component	Plasma membrane	IEA
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006814	Process	Sodium ion transport	IDA	12930796
GO:0006814	Process	Sodium ion transport	IEA
GO:0010765	Process	Positive regulation of sodium ion transport	IDA	17592081
GO:0014704	Component	Intercalated disc	IEA
GO:0014704	Component	Intercalated disc	ISS
GO:0016020	Component	Membrane	IEA
GO:0017080	Function	Sodium channel regulator activity	IBA
GO:0017080	Function	Sodium channel regulator activity	IDA	17592081, 24297919
GO:0019228	Process	Neuronal action potential	IDA	24297919
GO:0035725	Process	Sodium ion transmembrane transport	IDA	20226894
GO:0035725	Process	Sodium ion transmembrane transport	IEA
GO:0044325	Function	Transmembrane transporter binding	IBA
GO:0044325	Function	Transmembrane transporter binding	IPI	17592081
GO:0051649	Process	Establishment of localization in cell	IEA
GO:0060048	Process	Cardiac muscle contraction	IMP	17592081
GO:0060307	Process	Regulation of ventricular cardiac muscle cell membrane repolarization	IBA
GO:0060307	Process	Regulation of ventricular cardiac muscle cell membrane repolarization	IMP	17592081
GO:0061337	Process	Cardiac conduction	IBA
GO:0086002	Process	Cardiac muscle cell action potential involved in contraction	IBA
GO:0086002	Process	Cardiac muscle cell action potential involved in contraction	IMP	17592081
GO:0086006	Function	Voltage-gated sodium channel activity involved in cardiac muscle cell action potential	IMP	17592081
GO:0086012	Process	Membrane depolarization during cardiac muscle cell action potential	IBA
GO:0086012	Process	Membrane depolarization during cardiac muscle cell action potential	IMP	17592081
GO:0086016	Process	AV node cell action potential	IMP	17592081
GO:0086091	Process	Regulation of heart rate by cardiac conduction	IMP	17592081

MIM	HGNC	e!Ensembl
608256	10592	ENSG00000177098

Q8IWT1

Protein name

Sodium channel regulatory subunit beta-4

Protein function

Regulatory subunit of multiple voltage-gated sodium (Nav) channels directly mediating the depolarization of excitable membranes. Navs, also called VGSCs (voltage-gated sodium channels) or VDSCs (voltage-dependent sodium channels), operate by swi

PDB

4MZ2 , 4MZ3 , 5XAW , 6VSV , 7DTD

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07686	V-set	37 → 151	Immunoglobulin V-set domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed at a high level in dorsal root ganglia, at a lower level in brain, spinal cord, skeletal muscle and heart. Expressed in the atrium. {ECO:0000269|PubMed:12930796, ECO:0000269|PubMed:21051419}.

Sequence

MPGAGDGGKAPARWLGTGLLGLFLLPVTLSLEVSVGKATDIYAVNGTEILLPCTFSSCFG
FEDLHFRWTYNSSDAFKILIEGTVKNEKSDPKVTLKDDDRITLVGSTKEKMNNISIVLRD
LEFSDTGKYTCHVKNPKENNLQHHATIFLQVVDRLEEVDNTVTLIILAVVGGVIGLLILI
LLIKKLIIFILKKTREKKKECLVSSSGNDNTENGLPGSKAEEKPPSKV

Sequence length

228

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Atrial fibrillation, familial, 17	Pathogenic	rs587777559, rs587777560	RCV000128816 RCV000128817	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (16)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CARDIOMYOPATHY, DILATED	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiovascular phenotype	Uncertain significance; Likely benign; Benign; Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Catecholaminergic polymorphic ventricular tachycardia 1	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congenital long QT syndrome	Benign; Likely benign; Conflicting classifications of pathogenicity; Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FAMILIAL ATRIAL FIBRILLATION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FAMILIAL LONG QT SYNDROME	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEREDITARY ATRIAL FIBRILLATION	—	Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Long QT syndrome	Conflicting classifications of pathogenicity; Likely benign; Uncertain significance	ClinVar ClinGen, Disgenet ClinGen, Disgenet	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Long QT syndrome 10	Uncertain significance; Likely benign; Benign; Conflicting classifications of pathogenicity	ClinVar CTD, ClinVar, Disgenet, GenCC, HPO CTD, ClinVar, Disgenet, GenCC, HPO CTD, ClinVar, Disgenet, GenCC, HPO CTD, ClinVar, Disgenet, GenCC, HPO	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
PREECLAMPSIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Primary dilated cardiomyopathy	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ROMANO-WARD SYNDROME	—	Disgenet, Orphanet Disgenet, Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCN4B-related disorder	Conflicting classifications of pathogenicity; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SUDDEN INFANT DEATH SYNDROME	Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VENTRICULAR TACHYCARDIA, CATECHOLAMINERGIC POLYMORPHIC, 1, WITH OR WITHOUT ATRIAL DYSFUNCTION AND/OR DILATED CARDIOMYOPATHY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (38)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Atrial Fibrillation	Atrial Fibrillation	BEFREE	19808477, 21051419, 23604097, 30821358		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	30821358	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ATRIAL FIBRILLATION, FAMILIAL, 1 (disorder)	Atrial Fibrillation	ORPHANET_DG	23604097		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrioventricular Block	Atrioventricular block	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar disorder	Pubtator	26554713	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Borderline Personality Disorder	Borderline personality disorder	BEFREE	26554713		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	27917859		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	26554713		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brugada Syndrome	Brugada syndrome	Pubtator	31627867	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brugada Syndrome (disorder)	Brugada Syndrome	BEFREE	26179811		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital long QT syndrome	Congenital Long QT Syndrome	BEFREE	17592081		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congenital long QT syndrome	Congenital Long QT Syndrome	CLINGEN_DG	17592081		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congenital long QT syndrome	Congenital Long QT Syndrome	GENOMICS_ENGLAND_DG	17592081		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dysautonomia	Dysautonomia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy Temporal Lobe	Temporal lobe epilepsy	Pubtator	32331418	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial atrial fibrillation	Atrial Fibrillation	Orphanet			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	40527859	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Long QT Syndrome	Long QT Syndrome	LHGDN	17592081		★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Long QT Syndrome	Long QT Syndrome	GENOMICS_ENGLAND_DG	17592081		★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Long QT Syndrome	Long qt syndrome	Pubtator	17592081, 19029296	Associate	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Long QT Syndrome	Long QT Syndrome	BEFREE	24662403		★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Long Qt Syndrome 10	Long QT Syndrome	GENOMICS_ENGLAND_DG	17592081		★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Long Qt Syndrome 10	Long QT Syndrome	UNIPROT_DG	17592081, 23604097		★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Long Qt Syndrome 10	Long QT Syndrome	CTD_human_DG			★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Long Qt Syndrome 10	Long QT Syndrome	CLINVAR_DG			★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Long QT syndrome type 3	Long qt syndrome	Pubtator	17592081	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	27917859		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	27917859		★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	29723302		★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	34101221	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	32833340	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Romano-Ward syndrome	Romano-Ward Syndrome	Orphanet			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Romano-Ward Syndrome	Romano-Ward Syndrome	ORPHANET_DG	24093767		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Tachycardia Ventricular	Ventricular tachycardia	Pubtator	31020414	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Tachycardia, Ventricular	Ventricular tachycardia	BEFREE	31020414		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	29723302	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Tonic - clonic seizures	Seizure	BEFREE	20730464		★★★★★ ★☆☆☆☆ Found in Text Mining only
Torsades de Pointes	Torsades de Pointes	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only

SCN4B (sodium voltage-gated channel beta subunit 4)