Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	4250
Gene name	Secretoglobin family 2A member 2
Gene symbol	SCGB2A2
Synonyms (NCBI Gene)	MGB1PSBP1UGB2
Chromosome	11
Chromosome location	11q12.3

6 Show/Hide all (6)

miRTarBase ID	miRNA	Experiments	Reference
MIRT019036	hsa-miR-335-5p	Microarray	18185580
MIRT2321918	hsa-miR-103a	CLIP-seq
MIRT2321919	hsa-miR-107	CLIP-seq
MIRT2321920	hsa-miR-1273g	CLIP-seq
MIRT2321921	hsa-miR-1301	CLIP-seq
MIRT2321922	hsa-miR-5047	CLIP-seq

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	25416956
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IBA
GO:0030521	Process	Androgen receptor signaling pathway	IBA

MIM	HGNC	e!Ensembl
605562	7050	ENSG00000110484

Protein name

Mammaglobin-A (Mammaglobin-1) (Secretoglobin family 2A member 2)

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01099	Uteroglobin	1 → 90	Uteroglobin family	Domain

Tissue specificity

TISSUE SPECIFICITY: Mammary gland specific. Over-expressed in breast cancer.

Sequence

MKLLMVLMLAALSQHCYAGSGCPLLENVISKTINPQVSKTEYKELLQEFIDDNATTNAID
ELKECFLNQTDETLSNVEVFMQLIYDSSLCDLF

Sequence length

Interactions

View interactions

Related Genes Genes most often co-reported with SCGB2A2 across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for SCGB2A2.

Diseases Linked via Similar Genes Diseases curated for genes most similar to SCGB2A2 (see Related Genes above), that are NOT already directly curated for SCGB2A2 itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to SCGB2A2.

SCGB2A2 (secretoglobin family 2A member 2)