SCGB1D2 (secretoglobin family 1D member 2)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 10647
Gene name Secretoglobin family 1D member 2
Gene symbol SCGB1D2
Synonyms (NCBI Gene)
LIPBLPHBLPNB
Chromosome 11
Chromosome location 11q12.3
Summary The protein encoded by this gene is a member of the lipophilin subfamily, part of the uteroglobin superfamily, and is an ortholog of prostatein, the major secretory glycoprotein of the rat ventral prostate gland. Lipophilin gene products are widely expres
miRNA miRNA information provided by mirtarbase database.
12 Show/Hide all (12)
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT028973 hsa-miR-26b-5p Microarray 19088304
MIRT2321907 hsa-miR-1184 CLIP-seq
MIRT2321908 hsa-miR-1205 CLIP-seq
MIRT2321909 hsa-miR-181a CLIP-seq
MIRT2321910 hsa-miR-181b CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
4
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005576 Component Extracellular region IEA
GO:0005615 Component Extracellular space HDA 16502470
GO:0005615 Component Extracellular space IBA
GO:0005615 Component Extracellular space TAS 10066439
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
615061 18396 ENSG00000124935
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O95969
Protein name Secretoglobin family 1D member 2 (Lipophilin-B)
Protein function May bind androgens and other steroids, may also bind estramustine, a chemotherapeutic agent used for prostate cancer. May be under transcriptional regulation of steroid hormones.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01099 Uteroglobin 1 → 88 Uteroglobin family Domain
Tissue specificity TISSUE SPECIFICITY: Highest expression was found in skeletal muscle. Expressed as well in thymus, trachea, kidney, steroid responsive tissues (prostate, testis, uterus, breast and ovary) and salivary gland.
Sequence 
MKLSVCLLLVTLALCCYQANAEFCPALVSELLDFFFISEPLFKLSLAKFDAPPEAVAAKL
GVKRCTDQMSLQKRSLIAEVLVKILKKCSV
Sequence length 90
Interactions View interactions

No strongly related genes found yet for SCGB1D2.

No additional diseases found yet through genes similar to SCGB1D2.