SAPCD2 (suppressor APC domain containing 2)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Related genes Diseases linked via similar genes

Gene

• Entrez ID: 89958
• Gene name: Suppressor APC domain containing 2
• Gene symbol: SAPCD2
• Synonyms (NCBI Gene): C9orf140, p42.3
• Chromosome: 9
• Chromosome location: 9q34.3

miRNA Show/Hide all (50)

miRTarBase ID	miRNA	Experiments	Reference
MIRT006111	hsa-miR-29a-3p	Luciferase reporter assay, qRT-PCR, Western blot	21998710
MIRT006111	hsa-miR-29a-3p	Luciferase reporter assay, qRT-PCR, Western blot	21998710
MIRT006111	hsa-miR-29a-3p	Luciferase reporter assay, qRT-PCR, Western blot	21998710
MIRT006111	hsa-miR-29a-3p	Luciferase reporter assay, qRT-PCR, Western blot	21998710
MIRT006111	hsa-miR-29a-3p	Luciferase reporter assay, qRT-PCR, Western blot	21998710
MIRT006111	hsa-miR-29a-3p	Luciferase reporter assay, qRT-PCR, Western blot	21998710
MIRT006111	hsa-miR-29a-3p	Luciferase reporter assay, qRT-PCR, Western blot	21998710
MIRT006111	hsa-miR-29a-3p	Luciferase reporter assay, qRT-PCR, Western blot	21998710
MIRT006111	hsa-miR-29a-3p	Luciferase reporter assay, qRT-PCR, Western blot	21998710
MIRT006111	hsa-miR-29a-3p	Luciferase reporter assay, qRT-PCR, Western blot	21998710
MIRT006111	hsa-miR-29a-3p	Luciferase reporter assay, qRT-PCR, Western blot	21998710
MIRT006111	hsa-miR-29a-3p	Luciferase reporter assay, qRT-PCR, Western blot	21998710
MIRT046946	hsa-miR-221-3p	CLASH	23622248
MIRT046610	hsa-miR-222-3p	CLASH	23622248
MIRT709200	hsa-miR-504-5p	HITS-CLIP	19536157
MIRT709199	hsa-miR-10a-5p	HITS-CLIP	19536157
MIRT709198	hsa-miR-10b-5p	HITS-CLIP	19536157
MIRT709197	hsa-miR-6849-3p	HITS-CLIP	19536157
MIRT709196	hsa-miR-5193	HITS-CLIP	19536157
MIRT709195	hsa-miR-660-3p	HITS-CLIP	19536157
MIRT709194	hsa-miR-486-5p	HITS-CLIP	19536157
MIRT709193	hsa-miR-1913	HITS-CLIP	19536157
MIRT709192	hsa-miR-324-3p	HITS-CLIP	19536157
MIRT709191	hsa-miR-5699-5p	HITS-CLIP	19536157
MIRT709190	hsa-miR-4758-3p	HITS-CLIP	19536157
MIRT709189	hsa-miR-3189-5p	HITS-CLIP	19536157
MIRT709188	hsa-miR-6791-3p	HITS-CLIP	19536157
MIRT709187	hsa-miR-6829-3p	HITS-CLIP	19536157
MIRT709186	hsa-miR-492	HITS-CLIP	19536157
MIRT709185	hsa-miR-3649	HITS-CLIP	19536157
MIRT709184	hsa-miR-3144-5p	HITS-CLIP	19536157
MIRT006111	hsa-miR-29a-3p	ChIP-seq, Flow cytometry, Luciferase reporter assay, qRT-PCR, Western blotting	33683171
MIRT006111	hsa-miR-29a-3p	Luciferase reporter assay, Western blotting, qRT-PCR, Flow cytometry	33683171
MIRT709200	hsa-miR-504-5p	HITS-CLIP	19536157
MIRT709199	hsa-miR-10a-5p	HITS-CLIP	19536157
MIRT709198	hsa-miR-10b-5p	HITS-CLIP	19536157
MIRT709197	hsa-miR-6849-3p	HITS-CLIP	19536157
MIRT709196	hsa-miR-5193	HITS-CLIP	19536157
MIRT709195	hsa-miR-660-3p	HITS-CLIP	19536157
MIRT709194	hsa-miR-486-5p	HITS-CLIP	19536157
MIRT709193	hsa-miR-1913	HITS-CLIP	19536157
MIRT709192	hsa-miR-324-3p	HITS-CLIP	19536157
MIRT709191	hsa-miR-5699-5p	HITS-CLIP	19536157
MIRT709190	hsa-miR-4758-3p	HITS-CLIP	19536157
MIRT709189	hsa-miR-3189-5p	HITS-CLIP	19536157
MIRT709188	hsa-miR-6791-3p	HITS-CLIP	19536157
MIRT709187	hsa-miR-6829-3p	HITS-CLIP	19536157
MIRT709186	hsa-miR-492	HITS-CLIP	19536157
MIRT709185	hsa-miR-3649	HITS-CLIP	19536157
MIRT709184	hsa-miR-3144-5p	HITS-CLIP	19536157

Gene ontology (GO) Show/Hide all (24)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000132	Process	Establishment of mitotic spindle orientation	IEA
GO:0000132	Process	Establishment of mitotic spindle orientation	ISS
GO:0005515	Function	Protein binding	IPI	26766442, 28514442, 31980649, 32296183, 33961781
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005730	Component	Nucleolus	IDA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005886	Component	Plasma membrane	IEA
GO:0005923	Component	Bicellular tight junction	IEA
GO:0005938	Component	Cell cortex	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IMP	23576022, 23704824
GO:0016020	Component	Membrane	IEA
GO:0016324	Component	Apical plasma membrane	IEA
GO:0043296	Component	Apical junction complex	IDA	26766442
GO:0045179	Component	Apical cortex	IDA	26766442
GO:0045179	Component	Apical cortex	IEA
GO:0051301	Process	Cell division	IEA
GO:0070161	Component	Anchoring junction	IEA
GO:0090175	Process	Regulation of establishment of planar polarity	IEA
GO:0090175	Process	Regulation of establishment of planar polarity	ISS
GO:0098725	Process	Symmetric cell division	IEA
GO:0098725	Process	Symmetric cell division	ISS
GO:1904777	Process	Negative regulation of protein localization to cell cortex	IMP	26766442

Other IDs

• MIM: 612057
• HGNC: 28055
• e!Ensembl: ENSG00000186193

Protein

• UniProt ID: Q86UD0
• Protein name: Suppressor APC domain-containing protein 2 (Tumor specificity and mitosis phase-dependent expression protein) (TS/MDEP) (p42.3)
• Protein function: Plays a role in planar mitotic spindle orientation in retinal progenitor cells (RPCs) and promotes the production of symmetric terminal divisions (By similarity). Negatively regulates the mitotic apical cortex localization of GPSM2 (PubMed:26766
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF11414	Suppressor_APC	225 → 306		Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in 5-month-old fetal tissues, including stomach, intestine, colon, liver, brain, lung, heart, spleen and kidney (PubMed:17525738). Undetectable in non-cancerous adult tissues (PubMed:17525738). Expressed in many primary gastr
• Sequence:

  MAGAAMAERGRVPPPAPAPSTEGLPRAFLQSLRTLFDILDDRRRGCVHLREIESRWQGTD
  ARELPRGVLEGLRQVAPASGYLTFERFVAGLRTSLLSADGGPRDPTRAPARPGDQPPPPP
  QRLVFAPADEPRTVLERKPLPLGVRAPLAGPSAAARSPEQLCAPAEAAPCPAEPERSQSA
  ALEPSSSADAGAVACRALEADSGDARRAPRARGERRRHTIASGVDCGLLKQMKELEQEKE
  VLLQGLEMMARGRDWYQQQLQRVQERQRRLGQSRASADFGAAGSPRPLGRLLPKVQEVAR
  CLGELLAAACASRALPPSSSGPPCPALTSTSPPVWQQQTILMLKEQNRLLTQEVTEKSER
  ITQLEQEKSALIKQLFEARALSQQDGGPLDSTFI

• Sequence length: 394

Related Genes

No strongly related genes found yet for SAPCD2.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to SAPCD2.