SAP25 (Sin3A associated protein 25)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 100316904
Gene name Sin3A associated protein 25
Gene symbol SAP25
Synonyms (NCBI Gene)
-
Chromosome 7
Chromosome location 7q22.1
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
3
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005634 Component Nucleus IEA
GO:0005737 Component Cytoplasm IEA
GO:0006355 Process Regulation of DNA-templated transcription IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
619230 41908 ENSG00000205307
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8TEE9
Protein name Histone deacetylase complex subunit SAP25 (25 kDa Sin3-associated polypeptide) (Sin3 corepressor complex subunit SAP25)
Protein function Involved in the transcriptional repression mediated by the mSIN3A but not the N-CoR corepressor complex.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF15476 SAP25 1 → 199 Histone deacetylase complex subunit SAP25 Family
Sequence 
MTPLAPWDPKYEAKAGPRPVWGANCSSGASFSGRTLCHPSFWPLYEAASGRGLRPVAPAT
GHWNGQQAPPDAGFPVVCCEDVFLSDPLLPRGQRVPLYLSKAPQQMMGSLKLLPPPPIMS
ARVLPRPSPSRGPSTAWLSGPELIALTGLLQMSQGEPRPSSSAVGPPDHTSDPPSPCGSP
SSSQGADLSLPQTPDTHCP
Sequence length 199
Interactions View interactions

No strongly related genes found yet for SAP25.

No additional diseases found yet through genes similar to SAP25.