SAMD14 (sterile alpha motif domain containing 14)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 201191
• Gene name: Sterile alpha motif domain containing 14
• Gene symbol: SAMD14
• Synonyms (NCBI Gene): -
• Chromosome: 17
• Chromosome location: 17q21.33

miRNA Show/Hide all (49)

miRTarBase ID	miRNA	Experiments	Reference
MIRT029324	hsa-miR-26b-5p	Microarray	19088304
MIRT569783	hsa-miR-3154	PAR-CLIP	20371350
MIRT569782	hsa-miR-6873-5p	PAR-CLIP	20371350
MIRT569781	hsa-miR-4779	PAR-CLIP	20371350
MIRT569780	hsa-miR-6760-5p	PAR-CLIP	20371350
MIRT569779	hsa-miR-3179	PAR-CLIP	20371350
MIRT569778	hsa-miR-6770-5p	PAR-CLIP	20371350
MIRT569777	hsa-miR-4419a	PAR-CLIP	20371350
MIRT569776	hsa-miR-4510	PAR-CLIP	20371350
MIRT569775	hsa-miR-6127	PAR-CLIP	20371350
MIRT569774	hsa-miR-6129	PAR-CLIP	20371350
MIRT569773	hsa-miR-6130	PAR-CLIP	20371350
MIRT569772	hsa-miR-6133	PAR-CLIP	20371350
MIRT569771	hsa-miR-4434	PAR-CLIP	20371350
MIRT569770	hsa-miR-4516	PAR-CLIP	20371350
MIRT569769	hsa-miR-5703	PAR-CLIP	20371350
MIRT569767	hsa-miR-6878-5p	PAR-CLIP	20371350
MIRT569768	hsa-miR-6731-5p	PAR-CLIP	20371350
MIRT569766	hsa-miR-8085	PAR-CLIP	20371350
MIRT569765	hsa-miR-3175	PAR-CLIP	20371350
MIRT569764	hsa-miR-1206	PAR-CLIP	20371350
MIRT569763	hsa-miR-6853-3p	PAR-CLIP	20371350
MIRT569762	hsa-miR-4728-5p	PAR-CLIP	20371350
MIRT569783	hsa-miR-3154	PAR-CLIP	20371350
MIRT569782	hsa-miR-6873-5p	PAR-CLIP	20371350
MIRT569781	hsa-miR-4779	PAR-CLIP	20371350
MIRT569780	hsa-miR-6760-5p	PAR-CLIP	20371350
MIRT569779	hsa-miR-3179	PAR-CLIP	20371350
MIRT569778	hsa-miR-6770-5p	PAR-CLIP	20371350
MIRT569777	hsa-miR-4419a	PAR-CLIP	20371350
MIRT569776	hsa-miR-4510	PAR-CLIP	20371350
MIRT569775	hsa-miR-6127	PAR-CLIP	20371350
MIRT569774	hsa-miR-6129	PAR-CLIP	20371350
MIRT569773	hsa-miR-6130	PAR-CLIP	20371350
MIRT569772	hsa-miR-6133	PAR-CLIP	20371350
MIRT569771	hsa-miR-4434	PAR-CLIP	20371350
MIRT569770	hsa-miR-4516	PAR-CLIP	20371350
MIRT569769	hsa-miR-5703	PAR-CLIP	20371350
MIRT569767	hsa-miR-6878-5p	PAR-CLIP	20371350
MIRT569768	hsa-miR-6731-5p	PAR-CLIP	20371350
MIRT569766	hsa-miR-8085	PAR-CLIP	20371350
MIRT569765	hsa-miR-3175	PAR-CLIP	20371350
MIRT569764	hsa-miR-1206	PAR-CLIP	20371350
MIRT569763	hsa-miR-6853-3p	PAR-CLIP	20371350
MIRT569762	hsa-miR-4728-5p	PAR-CLIP	20371350
MIRT1325157	hsa-miR-1914	CLIP-seq
MIRT1325158	hsa-miR-4676-5p	CLIP-seq
MIRT1325159	hsa-miR-4707-3p	CLIP-seq
MIRT1325160	hsa-miR-575	CLIP-seq

Gene ontology (GO) Show/Hide all (8)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005737	Component	Cytoplasm	IBA
GO:0007015	Process	Actin filament organization	IBA
GO:0014069	Component	Postsynaptic density	IBA
GO:0015629	Component	Actin cytoskeleton	IBA
GO:0019722	Process	Calcium-mediated signaling	IBA
GO:0030425	Component	Dendrite	IBA
GO:0031175	Process	Neuron projection development	IBA
GO:0051015	Function	Actin filament binding	IBA

Other IDs

• MIM: 619233
• HGNC: 27312
• e!Ensembl: ENSG00000167100

Protein

• UniProt ID: Q8IZD0
• Protein name: Sterile alpha motif domain-containing protein 14 (SAM domain-containing protein 14)
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF07647	SAM_2	323 → 387	SAM domain (Sterile alpha motif)	Domain

• Sequence:

  MASSKLREPVDEVFDLDLAVPETARLDSSLHKARAQLLAKGRRHRPSRSRLRDSASSAED
  GEGSDGPGGKVTDGCGSPLHRLRSPLHSGPGSPAGGSFCLDPPGLRRSLDEDEPPPSPLT
  RYRPLHNAASHEGLAAASCSPPRSAPSSDSSPSFVRRHPRAEPHSEDDSRDASPPEPASP
  TIGLDKKTRRKFLDLGVTLRRASTGKSRKEKGSNRLSMGSRESVEGSGRSGGSPFLPFSW
  FTDSGKGSASSGSTTSPTCSPKHEGFSPKKSASQESTLSDDSTPPSSSPKIPSGPWQEAK
  CSYPYHTLSQSSDEFLDEPLPPVHHWTSQQVGQWLQSLNLEQYAAEFAARQVDGPQLLQL
  DGSKLKSLGLSNSHDRALVKRKLKEMAAAAEKERKAQEKAARQREKLRRREQEAKKS

• Sequence length: 417

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
EBV-positive nodal T- and NK-cell lymphoma	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SAMD14-related disorder	Uncertain significance; Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (8)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma	Adenocarcinoma	BEFREE	18823374		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	18823374		★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	BEFREE	28787589		★☆☆☆☆ Found in Text Mining only
beta Thalassemia	beta Thalassemia	BEFREE	28787589		★☆☆☆☆ Found in Text Mining only
beta^+^ Thalassemia	beta Thalassemia	BEFREE	28787589		★☆☆☆☆ Found in Text Mining only
Blood Coagulation Disorders	Blood coagulation disorder	Pubtator	21829388	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	22415137		★☆☆☆☆ Found in Text Mining only
Primary central nervous system lymphoma	Central Nervous System Lymphoma	BEFREE	30249786		★☆☆☆☆ Found in Text Mining only

Related Genes

No strongly related genes found yet for SAMD14.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to SAMD14.