SAFB2 (scaffold attachment factor B2)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 9667
• Gene name: Scaffold attachment factor B2
• Gene symbol: SAFB2
• Synonyms (NCBI Gene): -
• Chromosome: 19
• Chromosome location: 19p13.3
• Summary: The protein encoded by this gene, along with its paralog (scaffold attachment factor B1), is a repressor of estrogen receptor alpha. The encoded protein binds scaffold/matrix attachment region (S/MAR) DNA and is involved in cell cycle regulation, apoptosi

miRNA Show/Hide all (6)

miRTarBase ID	miRNA	Experiments	Reference
MIRT2096446	hsa-miR-1913	CLIP-seq
MIRT2096447	hsa-miR-324-3p	CLIP-seq
MIRT2096448	hsa-miR-346	CLIP-seq
MIRT2096449	hsa-miR-421	CLIP-seq
MIRT2096450	hsa-miR-4272	CLIP-seq
MIRT2096451	hsa-miR-4709-5p	CLIP-seq

Gene ontology (GO) Show/Hide all (18)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003676	Function	Nucleic acid binding	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003723	Function	RNA binding	HDA	22658674, 22681889
GO:0003723	Function	RNA binding	IEA
GO:0005515	Function	Protein binding	IPI	12660241, 20562859
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0016604	Component	Nuclear body	IDA
GO:0042802	Function	Identical protein binding	IPI	19674106
GO:0043565	Function	Sequence-specific DNA binding	IBA
GO:0050684	Process	Regulation of mRNA processing	IBA
GO:0060008	Process	Sertoli cell differentiation	IEA
GO:0060765	Process	Regulation of androgen receptor signaling pathway	IBA
GO:0060765	Process	Regulation of androgen receptor signaling pathway	IEA
GO:0070062	Component	Extracellular exosome	HDA	18570454

Other IDs

• MIM: 608066
• HGNC: 21605
• e!Ensembl: ENSG00000130254

Protein

• UniProt ID: Q14151
• Protein name: Scaffold attachment factor B2 (SAF-B2)
• Protein function: Binds to scaffold/matrix attachment region (S/MAR) DNA. Can function as an estrogen receptor corepressor and can also inhibit cell proliferation.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00076	RRM_1	409 → 479	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)	Domain
  PF02037	SAP	30 → 64	SAP domain	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed at high levels in the CNS and at low levels in the liver. Expressed in a wide number of breast cancer cell lines.
• Sequence:

  MAETLPGSGDSGPGTASLGPGVAETGTRRLSELRVIDLRAELKKRNLDTGGNKSVLMERL
  KKAVKEEGQDPDEIGIELEATSKKSAKRCVKGLKMEEEGTEDNGLEDDSRDGQEDMEASL
  ENLQNMGMMDMSVLDETEVANSSAPDFGEDGTDGLLDSFCDSKEYVAAQLRQLPAQPPEH
  AVDGEGFKNTLETSSLNFKVTPDIEESLLEPENEKILDILGETCKSEPVKEESSELEQPF
  AQDTSSVGPDRKLAEEEDLFDSAHPEEGDLDLASESTAHAQSSKADSLLAVVKREPAEQP
  GDGERTDCEPVGLEPAVEQSSAASELAEASSEELAEAPTEAPSPEARDSKEDGRKFDFDA
  CNEVPPAPKESSTSEGADQKMSSFKEEKDIKPIIKDEKGRVGSGSGRNLWVSGLSSTTRA
  TDLKNLFSKYGKVVGAKVVTNARSPGARCYGFVTMSTSDEATKCISHLHRTELHGRMISV
  EKAKNEPAGKKLSDRKECEVKKEKLSSVDRHHSVEIKIEKTVIKKEEKIEKKEEKKPEDI
  KKEEKDQDELKPGPTNRSRVTKSGSRGMERTVVMDKSKGEPVISVKTTSRSKERSSKSQD
  RKSESKEKRDILSFDKIKEQRERERQRQREREIRETERRREREQREREQRLEAFHERKEK
  ARLQRERLQLECQRQRLERERMERERLERERMRVERERRKEQERIHREREELRRQQEQLR
  YEQERRPGRRPYDLDRRDDAYWPEGKRVAMEDRYRADFPRPDHRFHDFDHRDRGQYQDHA
  IDRREGSRPMMGDHRDGQHYGDDRHGHGGPPERHGRDSRDGWGGYGSDKRLSEGRGLPPP
  PRGGRDWGEHNQRLEEHQARAWQGAMDAGAASREHARWQGGERGLSGPSGPGHMASRGGV
  AGRGGFAQGGHSQGHVVPGGGLEGGGVASQDRGSRVPHPHPHPPPYPHFTRRY

• Sequence length: 953

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Familial cancer of breast	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostate cancer	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (9)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Breast Cancer, Familial	Breast Cancer	BEFREE	19077293		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	19077293		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	19077293, 26273616	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	26482227	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	19901029	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	19077293		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	22817742		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	14587024, 19077293		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	19077293		★☆☆☆☆ Found in Text Mining only

Related Genes

No strongly related genes found yet for SAFB2.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to SAFB2.