S100G (S100 calcium binding protein G)

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 795
Gene name S100 calcium binding protein G
Gene symbol S100G
Synonyms (NCBI Gene)
CABPCABP1CABP9KCALB3
Chromosome X
Chromosome location Xp22.2
Summary This gene encodes calbindin D9K, a vitamin D-dependent calcium-binding protein. This cytosolic protein belongs to a family of calcium-binding proteins that includes calmodulin, parvalbumin, troponin C, and S100 protein. In the intestine, the protein is vi
miRNA miRNA information provided by mirtarbase database.
10 Show/Hide all (10)
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT023014 hsa-miR-124-3p Microarray 18668037
MIRT023934 hsa-miR-1-3p Microarray 18668037
MIRT2320446 hsa-miR-1275 CLIP-seq
MIRT2320447 hsa-miR-3692 CLIP-seq
MIRT2320448 hsa-miR-4260 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
11 Show/Hide all (11)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005499 Function Vitamin D binding IEA
GO:0005509 Function Calcium ion binding IBA
GO:0005509 Function Calcium ion binding IEA
GO:0005509 Function Calcium ion binding TAS 1610358
GO:0005515 Function Protein binding IPI 32296183
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
302020 1436 ENSG00000169906
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P29377
Protein name Protein S100-G (Calbindin-D9k) (S100 calcium-binding protein G) (Vitamin D-dependent calcium-binding protein, intestinal) (CABP)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00036 EF-hand_1 49 → 77 EF hand Domain
PF01023 S_100 6 → 45 S-100/ICaBP type calcium binding domain Domain
Sequence 
MSTKKSPEELKRIFEKYAAKEGDPDQLSKDELKLLIQAEFPSLLKGPNTLDDLFQELDKN
GDGEVSFEEFQVLVKKISQ
Sequence length 79
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
KEGG Pathway
Mineral absorption

No strongly related genes found yet for S100G.

No additional diseases found yet through genes similar to S100G.