S100A7L2 (S100 calcium binding protein A7 like 2)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 645922
Gene name S100 calcium binding protein A7 like 2
Gene symbol S100A7L2
Synonyms (NCBI Gene)
S100a7b
Chromosome 1
Chromosome location 1q21.3
Summary This locus is currently categorized as a non-transcribed pseudogene, but the locus type of this gene is unclear since it does contain an intact CDS. This locus lacks evidence indicating that it is transcribed, and very little of the upstream regions found
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
8 Show/Hide all (8)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005509 Function Calcium ion binding IBA
GO:0005509 Function Calcium ion binding IEA
GO:0005515 Function Protein binding IPI 32296183
GO:0005615 Component Extracellular space IDA 21805676
GO:0005737 Component Cytoplasm IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC 21655 N/A
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q5SY68
Protein name Protein S100-A7-like 2 (S100 calcium-binding protein A7-like 2)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01023 S_100 7 → 45 S-100/ICaBP type calcium binding domain Domain
Sequence 
MNIPLGEKVMLDIVAMFRQYSGDDGRMDMPGLVNLMKENFPNFLSGCEKSDMDYLSNALE
KKDDNKDKKVNYSEFLSLLGDITIDHHKIMHGVAPCSGGSQ
Sequence length 101
Interactions View interactions

No strongly related genes found yet for S100A7L2.

No additional diseases found yet through genes similar to S100A7L2.