Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	6274
Gene name	S100 calcium binding protein A3
Gene symbol	S100A3
Synonyms (NCBI Gene)	S100E
Chromosome	1
Chromosome location	1q21.3
Summary	The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of ce

16 Show/Hide all (16)

miRTarBase ID	miRNA	Experiments
MIRT1324058	hsa-miR-1233	CLIP-seq
MIRT1324059	hsa-miR-1285	CLIP-seq
MIRT1324060	hsa-miR-2861	CLIP-seq
MIRT1324061	hsa-miR-296-5p	CLIP-seq
MIRT1324062	hsa-miR-3187-5p	CLIP-seq
MIRT1324063	hsa-miR-326	CLIP-seq
MIRT1324064	hsa-miR-330-5p	CLIP-seq
MIRT1324065	hsa-miR-378g	CLIP-seq
MIRT1324066	hsa-miR-4486	CLIP-seq
MIRT1324067	hsa-miR-4533	CLIP-seq
MIRT1324068	hsa-miR-4687-5p	CLIP-seq
MIRT1324069	hsa-miR-612	CLIP-seq
MIRT1324070	hsa-miR-759	CLIP-seq
MIRT1324071	hsa-miR-760	CLIP-seq
MIRT2320433	hsa-miR-3936	CLIP-seq
MIRT2320434	hsa-miR-488	CLIP-seq

9 Show/Hide all (9)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005509	Function	Calcium ion binding	IBA
GO:0005515	Function	Protein binding	IPI	31837246, 32296183
GO:0005737	Component	Cytoplasm	IEA
GO:0005794	Component	Golgi apparatus	IDA
GO:0005829	Component	Cytosol	IDA
GO:0005886	Component	Plasma membrane	IDA
GO:0046872	Function	Metal ion binding	IEA
GO:0046914	Function	Transition metal ion binding	IEA
GO:0048306	Function	Calcium-dependent protein binding	IBA

MIM	HGNC	e!Ensembl
176992	10493	ENSG00000188015

P33764

Protein name

Protein S100-A3 (Protein S-100E) (S100 calcium-binding protein A3)

Protein function

Binds both calcium and zinc. May be involved in calcium-dependent cuticle cell differentiation, hair shaft and hair cuticular barrier formation.

PDB

1KSO , 3NSI , 3NSK , 3NSL , 3NSO

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01023	S_100	5 → 47	S-100/ICaBP type calcium binding domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Skin specific, specifically expressed at the inner endocuticle of hair fibers. {ECO:0000269|PubMed:12470658}.

Sequence

MARPLEQAVAAIVCTFQEYAGRCGDKYKLCQAELKELLQKELATWTPTEFRECDYNKFMS
VLDTNKDCEVDFVEYVRSLACLCLYCHEYFKDCPSEPPCSQ

Sequence length

101

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Prostate cancer	Uncertain significance	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (19)
Adenocarcinoma of large intestine	Colorectal Cancer	BEFREE	28381806		★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	9989446	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	30532072		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	28381806	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	33294444	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	Pubtator	21490620	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	34148033	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	30532072		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	28588665		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	18793447	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	30532072		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	18793447		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	38286121	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	25007175	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	18793447, 20083228, 28588665		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	28611294, 30558666, 33217795	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary fibrosis	Pubtator	31073086	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	18793447		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	18793447	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Genes Genes most often co-reported with S100A3 across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for S100A3.

Diseases Linked via Similar Genes Diseases curated for genes most similar to S100A3 (see Related Genes above), that are NOT already directly curated for S100A3 itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to S100A3.

S100A3 (S100 calcium binding protein A3)

Bookmark This Gene