S100A2 (S100 calcium binding protein A2)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Transcription factors Gene ontology Other IDs Protein Related genes Diseases linked via similar genes

Gene

• Entrez ID: 6273
• Gene name: S100 calcium binding protein A2
• Gene symbol: S100A2
• Synonyms (NCBI Gene): CAN19, S100L
• Chromosome: 1
• Chromosome location: 1q21.3
• Summary: The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of ce

miRNA Show/Hide all (46)

miRTarBase ID	miRNA	Experiments	Reference
MIRT022732	hsa-miR-124-3p	Microarray	18668037
MIRT025476	hsa-miR-34a-5p	Proteomics	21566225
MIRT025476	hsa-miR-34a-5p	Proteomics	21566225
MIRT029686	hsa-miR-26b-5p	Microarray	19088304
MIRT528719	hsa-miR-939-3p	PAR-CLIP	22012620
MIRT528718	hsa-miR-6852-5p	PAR-CLIP	22012620
MIRT528717	hsa-miR-6742-3p	PAR-CLIP	22012620
MIRT528716	hsa-miR-873-5p	PAR-CLIP	22012620
MIRT528715	hsa-miR-1207-5p	PAR-CLIP	22012620
MIRT528714	hsa-miR-4763-3p	PAR-CLIP	22012620
MIRT528713	hsa-miR-4736	PAR-CLIP	22012620
MIRT528712	hsa-miR-3136-3p	PAR-CLIP	22012620
MIRT528711	hsa-miR-7155-3p	PAR-CLIP	22012620
MIRT528710	hsa-miR-296-5p	PAR-CLIP	22012620
MIRT528709	hsa-miR-1343-3p	PAR-CLIP	22012620
MIRT528708	hsa-miR-6783-3p	PAR-CLIP	22012620
MIRT528707	hsa-miR-7150	PAR-CLIP	22012620
MIRT528706	hsa-miR-6724-5p	PAR-CLIP	22012620
MIRT528705	hsa-miR-6773-5p	PAR-CLIP	22012620
MIRT528719	hsa-miR-939-3p	PAR-CLIP	22012620
MIRT528718	hsa-miR-6852-5p	PAR-CLIP	22012620
MIRT528717	hsa-miR-6742-3p	PAR-CLIP	22012620
MIRT528716	hsa-miR-873-5p	PAR-CLIP	22012620
MIRT528715	hsa-miR-1207-5p	PAR-CLIP	22012620
MIRT528714	hsa-miR-4763-3p	PAR-CLIP	22012620
MIRT528713	hsa-miR-4736	PAR-CLIP	22012620
MIRT528712	hsa-miR-3136-3p	PAR-CLIP	22012620
MIRT528711	hsa-miR-7155-3p	PAR-CLIP	22012620
MIRT528710	hsa-miR-296-5p	PAR-CLIP	22012620
MIRT528709	hsa-miR-1343-3p	PAR-CLIP	22012620
MIRT528708	hsa-miR-6783-3p	PAR-CLIP	22012620
MIRT528707	hsa-miR-7150	PAR-CLIP	22012620
MIRT528706	hsa-miR-6724-5p	PAR-CLIP	22012620
MIRT528705	hsa-miR-6773-5p	PAR-CLIP	22012620
MIRT1324053	hsa-miR-3194-5p	CLIP-seq
MIRT1324054	hsa-miR-3688-3p	CLIP-seq
MIRT1324055	hsa-miR-4267	CLIP-seq
MIRT1324056	hsa-miR-4663	CLIP-seq
MIRT1324057	hsa-miR-766	CLIP-seq
MIRT2393972	hsa-miR-1323	CLIP-seq
MIRT2393973	hsa-miR-3910	CLIP-seq
MIRT2393974	hsa-miR-421	CLIP-seq
MIRT2393975	hsa-miR-4709-5p	CLIP-seq
MIRT2393976	hsa-miR-548an	CLIP-seq
MIRT2393977	hsa-miR-548o	CLIP-seq
MIRT2393978	hsa-miR-888	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
BRCA1	Activation	24556685

Gene ontology (GO) Show/Hide all (11)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005509	Function	Calcium ion binding	IBA
GO:0005509	Function	Calcium ion binding	IEA
GO:0005509	Function	Calcium ion binding	NAS	9481475
GO:0005515	Function	Protein binding	IPI	20188096, 20591429, 20965181, 25416956, 26871637, 31515488, 31837246, 32296183
GO:0042802	Function	Identical protein binding	IEA
GO:0042802	Function	Identical protein binding	IPI	16189514, 22394450, 25416956, 32296183
GO:0043542	Process	Endothelial cell migration	IBA
GO:0043542	Process	Endothelial cell migration	IMP	15313892
GO:0046872	Function	Metal ion binding	IEA
GO:0046914	Function	Transition metal ion binding	IEA
GO:0048306	Function	Calcium-dependent protein binding	IBA

Other IDs

• MIM: 176993
• HGNC: 10492
• e!Ensembl: ENSG00000196754

Protein

• UniProt ID: P29034
• Protein name: Protein S100-A2 (CAN19) (Protein S-100L) (S100 calcium-binding protein A2)
• Protein function: May function as calcium sensor and modulator, contributing to cellular calcium signaling. May function by interacting with other proteins, such as TPR-containing proteins, and indirectly play a role in many physiological processes. May also play
• PDB: 2RGI , 4DUQ
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01023	S_100	6 → 48	S-100/ICaBP type calcium binding domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: A subset of epithelial cells including normal human mammary epithelial cells and keratinocytes. {ECO:0000269|PubMed:1372446}.
• Sequence:

  MMCSSLEQALAVLVTTFHKYSCQEGDKFKLSKGEMKELLHKELPSFVGEKVDEEGLKKLM
  GSLDENSDQQVDFQEYAVFLALITVMCNDFFQGCPDRP

• Sequence length: 98

Related Genes

No strongly related genes found yet for S100A2.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to S100A2.