S100A13 (S100 calcium binding protein A13)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Related genes Diseases linked via similar genes

Gene

• Entrez ID: 6284
• Gene name: S100 calcium binding protein A13
• Gene symbol: S100A13
• Synonyms (NCBI Gene): -
• Chromosome: 1
• Chromosome location: 1q21.3
• Summary: The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of ce

miRNA Show/Hide all (16)

miRTarBase ID	miRNA	Experiments	Reference
MIRT1323890	hsa-miR-1291	CLIP-seq
MIRT1323891	hsa-miR-146b-3p	CLIP-seq
MIRT1323892	hsa-miR-1913	CLIP-seq
MIRT1323893	hsa-miR-3122	CLIP-seq
MIRT1323894	hsa-miR-3173-3p	CLIP-seq
MIRT1323895	hsa-miR-3173-5p	CLIP-seq
MIRT1323896	hsa-miR-3194-3p	CLIP-seq
MIRT1323897	hsa-miR-324-3p	CLIP-seq
MIRT1323898	hsa-miR-383	CLIP-seq
MIRT1323899	hsa-miR-3913-5p	CLIP-seq
MIRT1323900	hsa-miR-423-3p	CLIP-seq
MIRT1323901	hsa-miR-4747-5p	CLIP-seq
MIRT1323902	hsa-miR-4772-5p	CLIP-seq
MIRT1323903	hsa-miR-498	CLIP-seq
MIRT1323904	hsa-miR-767-3p	CLIP-seq
MIRT1323905	hsa-miR-874	CLIP-seq

Gene ontology (GO) Show/Hide all (31)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001819	Process	Positive regulation of cytokine production	IMP	20863990
GO:0005507	Function	Copper ion binding	IDA	12746488, 16145699
GO:0005509	Function	Calcium ion binding	IBA
GO:0005509	Function	Calcium ion binding	IDA	16145699, 17374362
GO:0005515	Function	Protein binding	IPI	12746488, 19284995, 25416956, 32296183, 36555597
GO:0005576	Component	Extracellular region	HDA	27068509
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	12746488
GO:0005634	Component	Nucleus	IDA	12118070, 15033494
GO:0005654	Component	Nucleoplasm	IDA
GO:0005730	Component	Nucleolus	IDA
GO:0005737	Component	Cytoplasm	IDA	15821778
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA	12746488
GO:0005886	Component	Plasma membrane	IDA
GO:0008270	Function	Zinc ion binding	IDA	12118070
GO:0008289	Function	Lipid binding	IEA
GO:0015031	Process	Protein transport	IEA
GO:0017134	Function	Fibroblast growth factor binding	IPI	11432880
GO:0032730	Process	Positive regulation of interleukin-1 alpha production	IDA	12746488
GO:0042803	Function	Protein homodimerization activity	IPI	12746488, 16145699
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IBA
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IDA	15033494
GO:0043303	Process	Mast cell degranulation	NAS	10051426
GO:0046872	Function	Metal ion binding	IEA
GO:0048306	Function	Calcium-dependent protein binding	IBA
GO:0048471	Component	Perinuclear region of cytoplasm	IBA
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	10722710
GO:0050786	Function	RAGE receptor binding	IBA
GO:0050786	Function	RAGE receptor binding	IPI	15033494

Other IDs

• MIM: 601989
• HGNC: 10490
• e!Ensembl: ENSG00000189171

Protein

• UniProt ID: Q99584
• Protein name: Protein S100-A13 (S100 calcium-binding protein A13)
• Protein function: Plays a role in the export of proteins that lack a signal peptide and are secreted by an alternative pathway. Binds two calcium ions per subunit. Binds one copper ion. Binding of one copper ion does not interfere with calcium binding. Required f
• PDB: 1YUR , 1YUS , 1YUT , 1YUU , 2EGD , 2H2K , 2K8M , 2KI4 , 2KI6 , 2KOT , 2L5X , 2LE9
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01023	S_100	9 → 51	S-100/ICaBP type calcium binding domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in heart and skeletal muscle.
• Sequence:

  MAAEPLTELEESIETVVTTFFTFARQEGRKDSLSVNEFKELVTQQLPHLLKDVGSLDEKM
  KSLDVNQDSELKFNEYWRLIGELAKEIRKKKDLKIRKK

• Sequence length: 98

Related Genes

No strongly related genes found yet for S100A13.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to S100A13.