RXRG (retinoid X receptor gamma)

Gene

• Entrez ID: 6258
• Gene name: Retinoid X receptor gamma
• Gene symbol: RXRG
• Synonyms (NCBI Gene): NR2B3, RXR-gamma, RXRC, RXRgamma
• Chromosome: 1
• Chromosome location: 1q23.3
• Summary: This gene encodes a member of the retinoid X receptor (RXR) family of nuclear receptors which are involved in mediating the antiproliferative effects of retinoic acid (RA). This receptor forms dimers with the retinoic acid, thyroid hormone, and vitamin D

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1323494	hsa-miR-106a	CLIP-seq
MIRT1323495	hsa-miR-106b	CLIP-seq
MIRT1323496	hsa-miR-17	CLIP-seq
MIRT1323497	hsa-miR-20a	CLIP-seq
MIRT1323498	hsa-miR-20b	CLIP-seq
MIRT1323499	hsa-miR-3160-5p	CLIP-seq
MIRT1323500	hsa-miR-3180-5p	CLIP-seq
MIRT1323501	hsa-miR-3689a-3p	CLIP-seq
MIRT1323502	hsa-miR-3689c	CLIP-seq
MIRT1323503	hsa-miR-3689d	CLIP-seq
MIRT1323504	hsa-miR-4685-5p	CLIP-seq
MIRT1323505	hsa-miR-4728-5p	CLIP-seq
MIRT1323506	hsa-miR-519d	CLIP-seq
MIRT1323507	hsa-miR-579	CLIP-seq
MIRT1323508	hsa-miR-765	CLIP-seq
MIRT1323509	hsa-miR-93	CLIP-seq
MIRT2320354	hsa-miR-1293	CLIP-seq
MIRT2320355	hsa-miR-1343	CLIP-seq
MIRT2320356	hsa-miR-2110	CLIP-seq
MIRT2320357	hsa-miR-23a	CLIP-seq
MIRT2320358	hsa-miR-23b	CLIP-seq
MIRT2320359	hsa-miR-23c	CLIP-seq
MIRT2320360	hsa-miR-3144-5p	CLIP-seq
MIRT2320361	hsa-miR-3150a-3p	CLIP-seq
MIRT2320362	hsa-miR-3175	CLIP-seq
MIRT1323500	hsa-miR-3180-5p	CLIP-seq
MIRT2320363	hsa-miR-3191	CLIP-seq
MIRT2320364	hsa-miR-4260	CLIP-seq
MIRT2320365	hsa-miR-4474-3p	CLIP-seq
MIRT2320366	hsa-miR-4476	CLIP-seq
MIRT2320367	hsa-miR-4483	CLIP-seq
MIRT2320368	hsa-miR-4511	CLIP-seq
MIRT2320369	hsa-miR-4652-5p	CLIP-seq
MIRT2320370	hsa-miR-4793-5p	CLIP-seq
MIRT2320371	hsa-miR-485-5p	CLIP-seq
MIRT2320372	hsa-miR-491-5p	CLIP-seq
MIRT2320373	hsa-miR-520a-5p	CLIP-seq
MIRT2320374	hsa-miR-525-5p	CLIP-seq
MIRT2320375	hsa-miR-939	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0003707	Function	Nuclear steroid receptor activity	IEA
GO:0004879	Function	Nuclear receptor activity	IBA
GO:0004879	Function	Nuclear receptor activity	IEA
GO:0004879	Function	Nuclear receptor activity	TAS	8034312
GO:0005515	Function	Protein binding	IPI	16189514, 20133701, 20211142, 21516116, 21900206, 21988832, 25303530, 25416956, 25910212, 28514442, 29892012, 31515488, 32296183, 32814053, 33961781
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0007399	Process	Nervous system development	IBA
GO:0008270	Function	Zinc ion binding	IEA
GO:0030154	Process	Cell differentiation	IBA
GO:0030518	Process	Nuclear receptor-mediated steroid hormone signaling pathway	IEA
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0044323	Function	Retinoic acid-responsive element binding	IBA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IBA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0048384	Process	Retinoic acid receptor signaling pathway	IBA
GO:0048384	Process	Retinoic acid receptor signaling pathway	IEA
GO:0090575	Component	RNA polymerase II transcription regulator complex	IBA
GO:0140693	Function	Molecular condensate scaffold activity	IDA	31881311
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

Other IDs

• MIM: 180247
• HGNC: 10479
• e!Ensembl: ENSG00000143171

Protein

• UniProt ID: P48443
• Protein name: Retinoic acid receptor RXR-gamma (Nuclear receptor subfamily 2 group B member 3) (Retinoid X receptor gamma)
• Protein function: Receptor for retinoic acid. Retinoic acid receptors bind as heterodimers to their target response elements in response to their ligands, all-trans or 9-cis retinoic acid, and regulate gene expression in various biological processes. The RAR/RXR
• PDB: 2GL8, 7A79
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF11825	Nuc_recep-AF1	25 → 134	Nuclear/hormone receptor activator site AF-1	Family
  PF00105	zf-C4	137 → 206	Zinc finger, C4 type (two domains)	Domain
  PF00104	Hormone_recep	255 → 443	Ligand-binding domain of nuclear hormone receptor	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in aortic endothelial cells (at protein level). {ECO:0000269|PubMed:28167758}.
• Sequence:

  MYGNYSHFMKFPAGYGGSPGHTGSTSMSPSAALSTGKPMDSHPSYTDTPVSAPRTLSAVG
  TPLNALGSPYRVITSAMGPPSGALAAPPGINLVAPPSSQLNVVNSVSSSEDIKPLPGLPG
  IGNMNYPSTSPGSLVKHICAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLIYTCRDNKD
  CLIDKRQRNRCQYCRYQKCLVMGMKREAVQEERQRSRERAESEAECATSGHEDMPVERIL
  EAELAVEPKTESYGDMNMENSTNDPVTNICHAADKQLFTLVEWAKRIPHFSDLTLEDQVI
  LLRAGWNELLIASFSHRSVSVQDGILLATGLHVHRSSAHSAGVGSIFDRVLTELVSKMKD
  MQMDKSELGCLRAIVLFNPDAKGLSNPSEVETLREKVYATLEAYTKQKYPEQPGRFAKLL
  LRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLETPLQIT

• Sequence length: 463

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ATRIAL FIBRILLATION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Anaplasia	Anaplasia	BEFREE	21355951		★☆☆☆☆ Found in Text Mining only
Aphasia	Aphasia	Pubtator	27251476	Associate	★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	GWASCAT_DG	27890468		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	GWASCAT_DG	27890468		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Carcinoma	Breast Carcinoma	BEFREE	28465354, 31558802		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	29073238, 31558802	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	40155870	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	40155870	Inhibit	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	24190430		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	31525256	Associate	★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	17707062		★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Developmental disability	Pubtator	27251476	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	12175776		★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	27636996, 34633445	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	12175776		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	12175776, 31808386		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	22180072		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	22180072	Associate	★☆☆☆☆ Found in Text Mining only
Eye Diseases	Eye disease	Pubtator	36490268	Associate	★☆☆☆☆ Found in Text Mining only
Generalized Thyroid Hormone Resistance	Thyroid Hormone Resistance	BEFREE	15186611		★☆☆☆☆ Found in Text Mining only
Hyperlipidemia, Familial Combined	Hyperlipidemia	BEFREE	17272748		★☆☆☆☆ Found in Text Mining only
Hyperlipidemia, Familial Combined	Hyperlipidemia	LHGDN	17272748		★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	27255444		★☆☆☆☆ Found in Text Mining only
Lipid Metabolism Disorders	Lipid Metabolism Disorders	BEFREE	12175776		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	31526458	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	31558802		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	17707062		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	24190430		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	30015907		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	25867398	Inhibit	★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	BEFREE	27255444		★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	CTD_human_DG	16214533		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neoplasms	Neoplasms	BEFREE	17707062, 21355951, 28823962, 31558802		★☆☆☆☆ Found in Text Mining only
NEUROTICISM	Neuroticism	BEFREE	21368711		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	20113835		★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	21355951		★☆☆☆☆ Found in Text Mining only
Prolactinoma	Prolactinoma	BEFREE	27245436		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	17707062		★☆☆☆☆ Found in Text Mining only
Sarcopenia	Sarcopenia	Pubtator	36147639	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	9716179		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	LHGDN	15299084		★☆☆☆☆ Found in Text Mining only