RXRA (retinoid X receptor alpha)

Gene

• Entrez ID: 6256
• Gene name: Retinoid X receptor alpha
• Gene symbol: RXRA
• Synonyms (NCBI Gene): NR2B1, RXR-alpha, RXRalpha
• Chromosome: 9
• Chromosome location: 9q34.2
• Summary: Retinoid X receptors (RXRs) and retinoic acid receptors (RARs) are nuclear receptors that mediate the biological effects of retinoids by their involvement in retinoic acid-mediated gene activation. These receptors function as transcription factors by bind

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs1057519958	C>A,T	Likely-pathogenic	Coding sequence variant, missense variant
rs1588299621	G>A	Likely-pathogenic	Coding sequence variant, missense variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT042547	hsa-miR-423-3p	CLASH	23622248
MIRT054229	hsa-miR-128-3p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23990020
MIRT054351	hsa-miR-574-3p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23626837
MIRT617638	hsa-miR-6782-3p	HITS-CLIP	23824327
MIRT617637	hsa-miR-488-5p	HITS-CLIP	23824327
MIRT617636	hsa-miR-4724-3p	HITS-CLIP	23824327
MIRT617635	hsa-miR-520a-5p	HITS-CLIP	23824327
MIRT617634	hsa-miR-525-5p	HITS-CLIP	23824327
MIRT617633	hsa-miR-7702	HITS-CLIP	23824327
MIRT617632	hsa-miR-3180-5p	HITS-CLIP	23824327
MIRT617631	hsa-miR-2681-5p	HITS-CLIP	23824327
MIRT543486	hsa-miR-4258	PAR-CLIP	20371350
MIRT543482	hsa-miR-4722-3p	PAR-CLIP	20371350
MIRT543483	hsa-miR-6727-3p	PAR-CLIP	20371350
MIRT543481	hsa-miR-6747-3p	PAR-CLIP	20371350
MIRT543480	hsa-miR-1976	PAR-CLIP	20371350
MIRT543479	hsa-miR-4769-3p	PAR-CLIP	20371350
MIRT543478	hsa-miR-6817-5p	PAR-CLIP	20371350
MIRT543477	hsa-miR-3692-3p	PAR-CLIP	20371350
MIRT543486	hsa-miR-4258	PAR-CLIP	20371350
MIRT543482	hsa-miR-4722-3p	PAR-CLIP	20371350
MIRT543483	hsa-miR-6727-3p	PAR-CLIP	20371350
MIRT543481	hsa-miR-6747-3p	PAR-CLIP	20371350
MIRT543480	hsa-miR-1976	PAR-CLIP	20371350
MIRT543479	hsa-miR-4769-3p	PAR-CLIP	20371350
MIRT543478	hsa-miR-6817-5p	PAR-CLIP	20371350
MIRT543477	hsa-miR-3692-3p	PAR-CLIP	20371350
MIRT543486	hsa-miR-4258	PAR-CLIP	21572407
MIRT543485	hsa-miR-4667-3p	PAR-CLIP	21572407
MIRT543484	hsa-miR-660-3p	PAR-CLIP	21572407
MIRT543482	hsa-miR-4722-3p	PAR-CLIP	21572407
MIRT543483	hsa-miR-6727-3p	PAR-CLIP	21572407
MIRT543481	hsa-miR-6747-3p	PAR-CLIP	21572407
MIRT543480	hsa-miR-1976	PAR-CLIP	21572407
MIRT543479	hsa-miR-4769-3p	PAR-CLIP	21572407
MIRT543478	hsa-miR-6817-5p	PAR-CLIP	21572407
MIRT543477	hsa-miR-3692-3p	PAR-CLIP	21572407
MIRT486423	hsa-miR-3940-3p	PAR-CLIP	23592263
MIRT486422	hsa-miR-596	PAR-CLIP	23592263
MIRT486421	hsa-miR-4532	PAR-CLIP	23592263
MIRT486420	hsa-miR-4734	PAR-CLIP	23592263
MIRT486419	hsa-miR-7106-5p	PAR-CLIP	23592263
MIRT486418	hsa-miR-486-3p	PAR-CLIP	23592263
MIRT617638	hsa-miR-6782-3p	HITS-CLIP	23824327
MIRT617637	hsa-miR-488-5p	HITS-CLIP	23824327
MIRT617636	hsa-miR-4724-3p	HITS-CLIP	23824327
MIRT617635	hsa-miR-520a-5p	HITS-CLIP	23824327
MIRT617634	hsa-miR-525-5p	HITS-CLIP	23824327
MIRT617633	hsa-miR-7702	HITS-CLIP	23824327
MIRT617632	hsa-miR-3180-5p	HITS-CLIP	23824327
MIRT617631	hsa-miR-2681-5p	HITS-CLIP	23824327
MIRT543486	hsa-miR-4258	PAR-CLIP	20371350
MIRT543482	hsa-miR-4722-3p	PAR-CLIP	20371350
MIRT543483	hsa-miR-6727-3p	PAR-CLIP	20371350
MIRT543481	hsa-miR-6747-3p	PAR-CLIP	20371350
MIRT543480	hsa-miR-1976	PAR-CLIP	20371350
MIRT543479	hsa-miR-4769-3p	PAR-CLIP	20371350
MIRT543478	hsa-miR-6817-5p	PAR-CLIP	20371350
MIRT543477	hsa-miR-3692-3p	PAR-CLIP	20371350
MIRT543486	hsa-miR-4258	PAR-CLIP	20371350
MIRT543482	hsa-miR-4722-3p	PAR-CLIP	20371350
MIRT543483	hsa-miR-6727-3p	PAR-CLIP	20371350
MIRT543481	hsa-miR-6747-3p	PAR-CLIP	20371350
MIRT543480	hsa-miR-1976	PAR-CLIP	20371350
MIRT543479	hsa-miR-4769-3p	PAR-CLIP	20371350
MIRT543478	hsa-miR-6817-5p	PAR-CLIP	20371350
MIRT543477	hsa-miR-3692-3p	PAR-CLIP	20371350
MIRT543486	hsa-miR-4258	PAR-CLIP	21572407
MIRT543485	hsa-miR-4667-3p	PAR-CLIP	21572407
MIRT543484	hsa-miR-660-3p	PAR-CLIP	21572407
MIRT543482	hsa-miR-4722-3p	PAR-CLIP	21572407
MIRT543483	hsa-miR-6727-3p	PAR-CLIP	21572407
MIRT543481	hsa-miR-6747-3p	PAR-CLIP	21572407
MIRT543480	hsa-miR-1976	PAR-CLIP	21572407
MIRT543479	hsa-miR-4769-3p	PAR-CLIP	21572407
MIRT543478	hsa-miR-6817-5p	PAR-CLIP	21572407
MIRT543477	hsa-miR-3692-3p	PAR-CLIP	21572407
MIRT486423	hsa-miR-3940-3p	PAR-CLIP	23592263
MIRT486422	hsa-miR-596	PAR-CLIP	23592263
MIRT486421	hsa-miR-4532	PAR-CLIP	23592263
MIRT486420	hsa-miR-4734	PAR-CLIP	23592263
MIRT486419	hsa-miR-7106-5p	PAR-CLIP	23592263
MIRT486418	hsa-miR-486-3p	PAR-CLIP	23592263
MIRT1323250	hsa-miR-1205	CLIP-seq
MIRT1323251	hsa-miR-1207-3p	CLIP-seq
MIRT1323252	hsa-miR-1207-5p	CLIP-seq
MIRT1323253	hsa-miR-1225-3p	CLIP-seq
MIRT1323254	hsa-miR-1233	CLIP-seq
MIRT1323255	hsa-miR-124	CLIP-seq
MIRT1323256	hsa-miR-1243	CLIP-seq
MIRT1323257	hsa-miR-1262	CLIP-seq
MIRT1323258	hsa-miR-1277	CLIP-seq
MIRT1323259	hsa-miR-128	CLIP-seq
MIRT1323260	hsa-miR-1293	CLIP-seq
MIRT1323261	hsa-miR-1298	CLIP-seq
MIRT1323262	hsa-miR-130a	CLIP-seq
MIRT1323263	hsa-miR-130b	CLIP-seq
MIRT1323264	hsa-miR-1321	CLIP-seq
MIRT1323265	hsa-miR-1324	CLIP-seq
MIRT1323266	hsa-miR-1343	CLIP-seq
MIRT1323267	hsa-miR-138	CLIP-seq
MIRT1323268	hsa-miR-145	CLIP-seq
MIRT1323269	hsa-miR-147b	CLIP-seq
MIRT1323270	hsa-miR-148a	CLIP-seq
MIRT1323271	hsa-miR-148b	CLIP-seq
MIRT1323272	hsa-miR-150	CLIP-seq
MIRT1323273	hsa-miR-152	CLIP-seq
MIRT1323274	hsa-miR-1825	CLIP-seq
MIRT1323275	hsa-miR-1908	CLIP-seq
MIRT1323276	hsa-miR-1909	CLIP-seq
MIRT1323277	hsa-miR-191	CLIP-seq
MIRT1323278	hsa-miR-197	CLIP-seq
MIRT1323279	hsa-miR-1972	CLIP-seq
MIRT1323280	hsa-miR-199a-5p	CLIP-seq
MIRT1323281	hsa-miR-199b-5p	CLIP-seq
MIRT1323282	hsa-miR-19a	CLIP-seq
MIRT1323283	hsa-miR-19b	CLIP-seq
MIRT1323284	hsa-miR-200b	CLIP-seq
MIRT1323285	hsa-miR-200c	CLIP-seq
MIRT1323286	hsa-miR-2117	CLIP-seq
MIRT1323287	hsa-miR-27a	CLIP-seq
MIRT1323288	hsa-miR-27b	CLIP-seq
MIRT1323289	hsa-miR-296-5p	CLIP-seq
MIRT1323290	hsa-miR-298	CLIP-seq
MIRT1323291	hsa-miR-301a	CLIP-seq
MIRT1323292	hsa-miR-301b	CLIP-seq
MIRT1323293	hsa-miR-3064-5p	CLIP-seq
MIRT1323294	hsa-miR-3120-3p	CLIP-seq
MIRT1323295	hsa-miR-3121-3p	CLIP-seq
MIRT1323296	hsa-miR-3126-5p	CLIP-seq
MIRT1323297	hsa-miR-3127-5p	CLIP-seq
MIRT1323298	hsa-miR-3150a-3p	CLIP-seq
MIRT1323299	hsa-miR-3153	CLIP-seq
MIRT1323300	hsa-miR-3155	CLIP-seq
MIRT1323301	hsa-miR-3155b	CLIP-seq
MIRT1323302	hsa-miR-3158-5p	CLIP-seq
MIRT1323303	hsa-miR-3160-3p	CLIP-seq
MIRT1323304	hsa-miR-3163	CLIP-seq
MIRT1323305	hsa-miR-3165	CLIP-seq
MIRT1323306	hsa-miR-3167	CLIP-seq
MIRT1323307	hsa-miR-3175	CLIP-seq
MIRT1323308	hsa-miR-3183	CLIP-seq
MIRT1323309	hsa-miR-3184	CLIP-seq
MIRT1323310	hsa-miR-3189-5p	CLIP-seq
MIRT1323311	hsa-miR-3197	CLIP-seq
MIRT1323312	hsa-miR-326	CLIP-seq
MIRT1323313	hsa-miR-330-5p	CLIP-seq
MIRT1323314	hsa-miR-338-3p	CLIP-seq
MIRT1323315	hsa-miR-3545-3p	CLIP-seq
MIRT1323316	hsa-miR-3613-3p	CLIP-seq
MIRT1323317	hsa-miR-3650	CLIP-seq
MIRT1323318	hsa-miR-3664-3p	CLIP-seq
MIRT1323319	hsa-miR-3666	CLIP-seq
MIRT1323320	hsa-miR-3667-3p	CLIP-seq
MIRT1323321	hsa-miR-371b-3p	CLIP-seq
MIRT1323322	hsa-miR-3918	CLIP-seq
MIRT1323323	hsa-miR-3926	CLIP-seq
MIRT1323324	hsa-miR-3934	CLIP-seq
MIRT1323325	hsa-miR-3974	CLIP-seq
MIRT1323326	hsa-miR-423-5p	CLIP-seq
MIRT1323327	hsa-miR-4252	CLIP-seq
MIRT1323328	hsa-miR-4261	CLIP-seq
MIRT1323329	hsa-miR-4267	CLIP-seq
MIRT1323330	hsa-miR-4269	CLIP-seq
MIRT1323331	hsa-miR-4273	CLIP-seq
MIRT1323332	hsa-miR-4279	CLIP-seq
MIRT1323333	hsa-miR-4282	CLIP-seq
MIRT1323334	hsa-miR-429	CLIP-seq
MIRT1323335	hsa-miR-4295	CLIP-seq
MIRT1323336	hsa-miR-4297	CLIP-seq
MIRT1323337	hsa-miR-4323	CLIP-seq
MIRT1323338	hsa-miR-4324	CLIP-seq
MIRT1323339	hsa-miR-4419a	CLIP-seq
MIRT1323340	hsa-miR-4433	CLIP-seq
MIRT739035	hsa-miR-4436b-3p	CLIP-seq
MIRT1323341	hsa-miR-4438	CLIP-seq
MIRT1323342	hsa-miR-4446-3p	CLIP-seq
MIRT1323343	hsa-miR-4459	CLIP-seq
MIRT1323344	hsa-miR-4473	CLIP-seq
MIRT1323345	hsa-miR-4475	CLIP-seq
MIRT1323346	hsa-miR-4476	CLIP-seq
MIRT1323347	hsa-miR-4483	CLIP-seq
MIRT1323348	hsa-miR-4487	CLIP-seq
MIRT1323349	hsa-miR-4493	CLIP-seq
MIRT1323350	hsa-miR-4505	CLIP-seq
MIRT1323351	hsa-miR-4509	CLIP-seq
MIRT1323352	hsa-miR-4510	CLIP-seq
MIRT1323353	hsa-miR-4512	CLIP-seq
MIRT1323354	hsa-miR-4514	CLIP-seq
MIRT1323355	hsa-miR-4539	CLIP-seq
MIRT1323356	hsa-miR-454	CLIP-seq
MIRT1323357	hsa-miR-4645-5p	CLIP-seq
MIRT1323358	hsa-miR-4646-5p	CLIP-seq
MIRT1323359	hsa-miR-4650-5p	CLIP-seq
MIRT1323360	hsa-miR-4660	CLIP-seq
MIRT1323361	hsa-miR-4666-5p	CLIP-seq
MIRT1323362	hsa-miR-4667-5p	CLIP-seq
MIRT1323363	hsa-miR-4668-5p	CLIP-seq
MIRT1323364	hsa-miR-4671-3p	CLIP-seq
MIRT1323365	hsa-miR-4673	CLIP-seq
MIRT1323366	hsa-miR-4675	CLIP-seq
MIRT1323367	hsa-miR-4681	CLIP-seq
MIRT1323368	hsa-miR-4687-5p	CLIP-seq
MIRT1323369	hsa-miR-4691-3p	CLIP-seq
MIRT1323370	hsa-miR-4692	CLIP-seq
MIRT1323371	hsa-miR-4700-5p	CLIP-seq
MIRT1323372	hsa-miR-4701-3p	CLIP-seq
MIRT1323373	hsa-miR-4704-3p	CLIP-seq
MIRT1323374	hsa-miR-4706	CLIP-seq
MIRT1323375	hsa-miR-4713-3p	CLIP-seq
MIRT1323376	hsa-miR-4714-3p	CLIP-seq
MIRT1323377	hsa-miR-4723-3p	CLIP-seq
MIRT1323378	hsa-miR-4728-5p	CLIP-seq
MIRT1323379	hsa-miR-4731-5p	CLIP-seq
MIRT1323380	hsa-miR-4732-5p	CLIP-seq
MIRT1323381	hsa-miR-4733-3p	CLIP-seq
MIRT1323382	hsa-miR-4739	CLIP-seq
MIRT1323383	hsa-miR-4741	CLIP-seq
MIRT1323384	hsa-miR-4744	CLIP-seq
MIRT1323385	hsa-miR-4747-5p	CLIP-seq
MIRT1323386	hsa-miR-4749-5p	CLIP-seq
MIRT1323387	hsa-miR-4753-5p	CLIP-seq
MIRT1323388	hsa-miR-4755-3p	CLIP-seq
MIRT1323389	hsa-miR-4756-5p	CLIP-seq
MIRT1323390	hsa-miR-4758-3p	CLIP-seq
MIRT1323391	hsa-miR-4763-3p	CLIP-seq
MIRT1323392	hsa-miR-4766-5p	CLIP-seq
MIRT1323393	hsa-miR-4768-3p	CLIP-seq
MIRT1323394	hsa-miR-4779	CLIP-seq
MIRT1323395	hsa-miR-4793-5p	CLIP-seq
MIRT1323396	hsa-miR-4795-5p	CLIP-seq
MIRT1323397	hsa-miR-484	CLIP-seq
MIRT1323398	hsa-miR-493	CLIP-seq
MIRT1323399	hsa-miR-506	CLIP-seq
MIRT1323400	hsa-miR-509-3p	CLIP-seq
MIRT1323401	hsa-miR-5096	CLIP-seq
MIRT1323402	hsa-miR-510	CLIP-seq
MIRT1323403	hsa-miR-512-3p	CLIP-seq
MIRT1323404	hsa-miR-512-5p	CLIP-seq
MIRT1323405	hsa-miR-513a-5p	CLIP-seq
MIRT1323406	hsa-miR-520d-5p	CLIP-seq
MIRT1323407	hsa-miR-520f	CLIP-seq
MIRT1323408	hsa-miR-524-5p	CLIP-seq
MIRT1323409	hsa-miR-548a-5p	CLIP-seq
MIRT1323410	hsa-miR-548aa	CLIP-seq
MIRT1323411	hsa-miR-548ab	CLIP-seq
MIRT1323412	hsa-miR-548ak	CLIP-seq
MIRT1323413	hsa-miR-548b-5p	CLIP-seq
MIRT1323414	hsa-miR-548c-3p	CLIP-seq
MIRT1323415	hsa-miR-548c-5p	CLIP-seq
MIRT1323416	hsa-miR-548d-5p	CLIP-seq
MIRT1323417	hsa-miR-548h	CLIP-seq
MIRT1323418	hsa-miR-548i	CLIP-seq
MIRT1323419	hsa-miR-548j	CLIP-seq
MIRT1323420	hsa-miR-548k	CLIP-seq
MIRT1323421	hsa-miR-548l	CLIP-seq
MIRT1323422	hsa-miR-548n	CLIP-seq
MIRT1323423	hsa-miR-548w	CLIP-seq
MIRT1323424	hsa-miR-548y	CLIP-seq
MIRT1323425	hsa-miR-552	CLIP-seq
MIRT1323426	hsa-miR-555	CLIP-seq
MIRT1323427	hsa-miR-556-5p	CLIP-seq
MIRT1323428	hsa-miR-558	CLIP-seq
MIRT1323429	hsa-miR-559	CLIP-seq
MIRT1323430	hsa-miR-570	CLIP-seq
MIRT1323431	hsa-miR-583	CLIP-seq
MIRT1323432	hsa-miR-604	CLIP-seq
MIRT1323433	hsa-miR-634	CLIP-seq
MIRT1323434	hsa-miR-635	CLIP-seq
MIRT1323435	hsa-miR-647	CLIP-seq
MIRT1323436	hsa-miR-663	CLIP-seq
MIRT1323437	hsa-miR-664	CLIP-seq
MIRT1323438	hsa-miR-760	CLIP-seq
MIRT1323439	hsa-miR-876-5p	CLIP-seq
MIRT1323440	hsa-miR-885-3p	CLIP-seq
MIRT1323441	hsa-miR-887	CLIP-seq
MIRT1323442	hsa-miR-939	CLIP-seq
MIRT739035	hsa-miR-4436b-3p	CLIP-seq
MIRT1323350	hsa-miR-4505	CLIP-seq
MIRT1323379	hsa-miR-4731-5p	CLIP-seq
MIRT1556998	hsa-miR-3194-5p	CLIP-seq
MIRT739035	hsa-miR-4436b-3p	CLIP-seq
MIRT739035	hsa-miR-4436b-3p	CLIP-seq
MIRT739035	hsa-miR-4436b-3p	CLIP-seq
MIRT2095893	hsa-miR-10a	CLIP-seq
MIRT2095894	hsa-miR-10b	CLIP-seq
MIRT2095895	hsa-miR-1180	CLIP-seq
MIRT2095896	hsa-miR-1184	CLIP-seq
MIRT2095897	hsa-miR-1197	CLIP-seq
MIRT1323250	hsa-miR-1205	CLIP-seq
MIRT1323251	hsa-miR-1207-3p	CLIP-seq
MIRT1323252	hsa-miR-1207-5p	CLIP-seq
MIRT2095898	hsa-miR-1224-3p	CLIP-seq
MIRT2095899	hsa-miR-1238	CLIP-seq
MIRT1323255	hsa-miR-124	CLIP-seq
MIRT1323256	hsa-miR-1243	CLIP-seq
MIRT2095900	hsa-miR-1246	CLIP-seq
MIRT2095901	hsa-miR-1253	CLIP-seq
MIRT2095902	hsa-miR-1260	CLIP-seq
MIRT2095903	hsa-miR-1260b	CLIP-seq
MIRT1323258	hsa-miR-1277	CLIP-seq
MIRT1323259	hsa-miR-128	CLIP-seq
MIRT2095904	hsa-miR-1280	CLIP-seq
MIRT2095905	hsa-miR-1301	CLIP-seq
MIRT1323262	hsa-miR-130a	CLIP-seq
MIRT1323263	hsa-miR-130b	CLIP-seq
MIRT2095906	hsa-miR-132	CLIP-seq
MIRT1323264	hsa-miR-1321	CLIP-seq
MIRT1323265	hsa-miR-1324	CLIP-seq
MIRT2095907	hsa-miR-141	CLIP-seq
MIRT1323268	hsa-miR-145	CLIP-seq
MIRT2095908	hsa-miR-1470	CLIP-seq
MIRT1323270	hsa-miR-148a	CLIP-seq
MIRT1323271	hsa-miR-148b	CLIP-seq
MIRT2095909	hsa-miR-149	CLIP-seq
MIRT1323273	hsa-miR-152	CLIP-seq
MIRT1323274	hsa-miR-1825	CLIP-seq
MIRT2095910	hsa-miR-186	CLIP-seq
MIRT1323276	hsa-miR-1909	CLIP-seq
MIRT2095911	hsa-miR-1913	CLIP-seq
MIRT1323278	hsa-miR-197	CLIP-seq
MIRT1323279	hsa-miR-1972	CLIP-seq
MIRT1323280	hsa-miR-199a-5p	CLIP-seq
MIRT1323281	hsa-miR-199b-5p	CLIP-seq
MIRT1323282	hsa-miR-19a	CLIP-seq
MIRT1323283	hsa-miR-19b	CLIP-seq
MIRT2095912	hsa-miR-200a	CLIP-seq
MIRT1323284	hsa-miR-200b	CLIP-seq
MIRT1323285	hsa-miR-200c	CLIP-seq
MIRT1323286	hsa-miR-2117	CLIP-seq
MIRT2095913	hsa-miR-212	CLIP-seq
MIRT2095914	hsa-miR-216b	CLIP-seq
MIRT2095915	hsa-miR-2277-3p	CLIP-seq
MIRT2095916	hsa-miR-2278	CLIP-seq
MIRT2095917	hsa-miR-24	CLIP-seq
MIRT2095918	hsa-miR-2467-5p	CLIP-seq
MIRT2095919	hsa-miR-2682	CLIP-seq
MIRT1323287	hsa-miR-27a	CLIP-seq
MIRT1323288	hsa-miR-27b	CLIP-seq
MIRT1323289	hsa-miR-296-5p	CLIP-seq
MIRT1323291	hsa-miR-301a	CLIP-seq
MIRT1323292	hsa-miR-301b	CLIP-seq
MIRT1323293	hsa-miR-3064-5p	CLIP-seq
MIRT2095920	hsa-miR-3119	CLIP-seq
MIRT1323295	hsa-miR-3121-3p	CLIP-seq
MIRT1323296	hsa-miR-3126-5p	CLIP-seq
MIRT1323297	hsa-miR-3127-5p	CLIP-seq
MIRT2095921	hsa-miR-3135	CLIP-seq
MIRT2095922	hsa-miR-3136-3p	CLIP-seq
MIRT1323299	hsa-miR-3153	CLIP-seq
MIRT1323300	hsa-miR-3155	CLIP-seq
MIRT1323301	hsa-miR-3155b	CLIP-seq
MIRT1323303	hsa-miR-3160-3p	CLIP-seq
MIRT2095923	hsa-miR-3160-5p	CLIP-seq
MIRT1323305	hsa-miR-3165	CLIP-seq
MIRT2095924	hsa-miR-3173-3p	CLIP-seq
MIRT1323308	hsa-miR-3183	CLIP-seq
MIRT2095925	hsa-miR-3188	CLIP-seq
MIRT2095926	hsa-miR-3192	CLIP-seq
MIRT2095927	hsa-miR-3193	CLIP-seq
MIRT1556998	hsa-miR-3194-5p	CLIP-seq
MIRT2095928	hsa-miR-3195	CLIP-seq
MIRT2095929	hsa-miR-3200-3p	CLIP-seq
MIRT2095930	hsa-miR-320a	CLIP-seq
MIRT2095931	hsa-miR-320b	CLIP-seq
MIRT2095932	hsa-miR-320c	CLIP-seq
MIRT2095933	hsa-miR-320d	CLIP-seq
MIRT2095934	hsa-miR-324-3p	CLIP-seq
MIRT1323314	hsa-miR-338-3p	CLIP-seq
MIRT2095935	hsa-miR-342-5p	CLIP-seq
MIRT2095936	hsa-miR-34a	CLIP-seq
MIRT2095937	hsa-miR-34c-5p	CLIP-seq
MIRT1323315	hsa-miR-3545-3p	CLIP-seq
MIRT2095938	hsa-miR-3591-3p	CLIP-seq
MIRT1323316	hsa-miR-3613-3p	CLIP-seq
MIRT2095939	hsa-miR-3616-3p	CLIP-seq
MIRT2095940	hsa-miR-3622a-3p	CLIP-seq
MIRT2095941	hsa-miR-3622b-3p	CLIP-seq
MIRT2095942	hsa-miR-3652	CLIP-seq
MIRT1323318	hsa-miR-3664-3p	CLIP-seq
MIRT1323319	hsa-miR-3666	CLIP-seq
MIRT2095943	hsa-miR-3667-5p	CLIP-seq
MIRT2095944	hsa-miR-3714	CLIP-seq
MIRT2095945	hsa-miR-378g	CLIP-seq
MIRT2095946	hsa-miR-3910	CLIP-seq
MIRT2095947	hsa-miR-3917	CLIP-seq
MIRT2095948	hsa-miR-3919	CLIP-seq
MIRT2095949	hsa-miR-3925-3p	CLIP-seq
MIRT2095950	hsa-miR-3929	CLIP-seq
MIRT2095951	hsa-miR-3942-3p	CLIP-seq
MIRT2095952	hsa-miR-3975	CLIP-seq
MIRT2095953	hsa-miR-3978	CLIP-seq
MIRT2095954	hsa-miR-4251	CLIP-seq
MIRT1323327	hsa-miR-4252	CLIP-seq
MIRT1323328	hsa-miR-4261	CLIP-seq
MIRT1323329	hsa-miR-4267	CLIP-seq
MIRT1323330	hsa-miR-4269	CLIP-seq
MIRT2095955	hsa-miR-4270	CLIP-seq
MIRT1323331	hsa-miR-4273	CLIP-seq
MIRT2095956	hsa-miR-4276	CLIP-seq
MIRT2095957	hsa-miR-4286	CLIP-seq
MIRT1323334	hsa-miR-429	CLIP-seq
MIRT2095958	hsa-miR-4290	CLIP-seq
MIRT2095959	hsa-miR-4292	CLIP-seq
MIRT1323335	hsa-miR-4295	CLIP-seq
MIRT1323336	hsa-miR-4297	CLIP-seq
MIRT2095960	hsa-miR-4300	CLIP-seq
MIRT2095961	hsa-miR-4308	CLIP-seq
MIRT1323338	hsa-miR-4324	CLIP-seq
MIRT1323339	hsa-miR-4419a	CLIP-seq
MIRT2095962	hsa-miR-4419b	CLIP-seq
MIRT2095963	hsa-miR-4421	CLIP-seq
MIRT2095964	hsa-miR-4423-3p	CLIP-seq
MIRT2095965	hsa-miR-4428	CLIP-seq
MIRT2095966	hsa-miR-4429	CLIP-seq
MIRT2095967	hsa-miR-4430	CLIP-seq
MIRT2095968	hsa-miR-4435	CLIP-seq
MIRT2095969	hsa-miR-4436a	CLIP-seq
MIRT739035	hsa-miR-4436b-3p	CLIP-seq
MIRT2095970	hsa-miR-4437	CLIP-seq
MIRT1323341	hsa-miR-4438	CLIP-seq
MIRT2095971	hsa-miR-4441	CLIP-seq
MIRT1323342	hsa-miR-4446-3p	CLIP-seq
MIRT1323343	hsa-miR-4459	CLIP-seq
MIRT2095972	hsa-miR-4467	CLIP-seq
MIRT2095973	hsa-miR-4468	CLIP-seq
MIRT1323344	hsa-miR-4473	CLIP-seq
MIRT1323346	hsa-miR-4476	CLIP-seq
MIRT2095974	hsa-miR-4478	CLIP-seq
MIRT1323348	hsa-miR-4487	CLIP-seq
MIRT2095975	hsa-miR-4490	CLIP-seq
MIRT2095976	hsa-miR-4492	CLIP-seq
MIRT1323349	hsa-miR-4493	CLIP-seq
MIRT2095977	hsa-miR-4498	CLIP-seq
MIRT2095978	hsa-miR-449a	CLIP-seq
MIRT2095979	hsa-miR-449b	CLIP-seq
MIRT2095980	hsa-miR-449c	CLIP-seq
MIRT2095981	hsa-miR-4504	CLIP-seq
MIRT1323350	hsa-miR-4505	CLIP-seq
MIRT1323351	hsa-miR-4509	CLIP-seq
MIRT1323352	hsa-miR-4510	CLIP-seq
MIRT1323353	hsa-miR-4512	CLIP-seq
MIRT1323354	hsa-miR-4514	CLIP-seq
MIRT2095982	hsa-miR-4519	CLIP-seq
MIRT2095983	hsa-miR-4520a-5p	CLIP-seq
MIRT2095984	hsa-miR-4520b-5p	CLIP-seq
MIRT2095985	hsa-miR-4530	CLIP-seq
MIRT1323356	hsa-miR-454	CLIP-seq
MIRT2095986	hsa-miR-4640-3p	CLIP-seq
MIRT1323357	hsa-miR-4645-5p	CLIP-seq
MIRT1323358	hsa-miR-4646-5p	CLIP-seq
MIRT2095987	hsa-miR-4649-3p	CLIP-seq
MIRT1323359	hsa-miR-4650-5p	CLIP-seq
MIRT1323360	hsa-miR-4660	CLIP-seq
MIRT2095988	hsa-miR-4664-5p	CLIP-seq
MIRT1323363	hsa-miR-4668-5p	CLIP-seq
MIRT1323364	hsa-miR-4671-3p	CLIP-seq
MIRT2095989	hsa-miR-4671-5p	CLIP-seq
MIRT1323365	hsa-miR-4673	CLIP-seq
MIRT2095990	hsa-miR-4677-3p	CLIP-seq
MIRT2095991	hsa-miR-4685-5p	CLIP-seq
MIRT1323368	hsa-miR-4687-5p	CLIP-seq
MIRT2095992	hsa-miR-4690-3p	CLIP-seq
MIRT1323369	hsa-miR-4691-3p	CLIP-seq
MIRT1323370	hsa-miR-4692	CLIP-seq
MIRT2095993	hsa-miR-4699-5p	CLIP-seq
MIRT2095994	hsa-miR-4700-3p	CLIP-seq
MIRT1323373	hsa-miR-4704-3p	CLIP-seq
MIRT2095995	hsa-miR-4708-3p	CLIP-seq
MIRT1323375	hsa-miR-4713-3p	CLIP-seq
MIRT1323376	hsa-miR-4714-3p	CLIP-seq
MIRT2095996	hsa-miR-4715-3p	CLIP-seq
MIRT2095997	hsa-miR-4717-5p	CLIP-seq
MIRT1323377	hsa-miR-4723-3p	CLIP-seq
MIRT2095998	hsa-miR-4725-5p	CLIP-seq
MIRT1323378	hsa-miR-4728-5p	CLIP-seq
MIRT2095999	hsa-miR-4730	CLIP-seq
MIRT1323379	hsa-miR-4731-5p	CLIP-seq
MIRT1323380	hsa-miR-4732-5p	CLIP-seq
MIRT1323381	hsa-miR-4733-3p	CLIP-seq
MIRT2096000	hsa-miR-4738-5p	CLIP-seq
MIRT1323382	hsa-miR-4739	CLIP-seq
MIRT1323384	hsa-miR-4744	CLIP-seq
MIRT2096001	hsa-miR-4747-3p	CLIP-seq
MIRT1323385	hsa-miR-4747-5p	CLIP-seq
MIRT2096002	hsa-miR-4753-3p	CLIP-seq
MIRT1323387	hsa-miR-4753-5p	CLIP-seq
MIRT1323388	hsa-miR-4755-3p	CLIP-seq
MIRT2096003	hsa-miR-4756-3p	CLIP-seq
MIRT1323389	hsa-miR-4756-5p	CLIP-seq
MIRT1323391	hsa-miR-4763-3p	CLIP-seq
MIRT1323392	hsa-miR-4766-5p	CLIP-seq
MIRT2096004	hsa-miR-4768-5p	CLIP-seq
MIRT2096005	hsa-miR-4773	CLIP-seq
MIRT1323394	hsa-miR-4779	CLIP-seq
MIRT1323395	hsa-miR-4793-5p	CLIP-seq
MIRT2096006	hsa-miR-4794	CLIP-seq
MIRT1323396	hsa-miR-4795-5p	CLIP-seq
MIRT2096007	hsa-miR-483-3p	CLIP-seq
MIRT1323397	hsa-miR-484	CLIP-seq
MIRT2096008	hsa-miR-485-5p	CLIP-seq
MIRT2096009	hsa-miR-488	CLIP-seq
MIRT1323398	hsa-miR-493	CLIP-seq
MIRT2096010	hsa-miR-504	CLIP-seq
MIRT2096011	hsa-miR-5047	CLIP-seq
MIRT1323399	hsa-miR-506	CLIP-seq
MIRT2096012	hsa-miR-508-5p	CLIP-seq
MIRT1323400	hsa-miR-509-3p	CLIP-seq
MIRT1323401	hsa-miR-5096	CLIP-seq
MIRT1323403	hsa-miR-512-3p	CLIP-seq
MIRT1323404	hsa-miR-512-5p	CLIP-seq
MIRT1323405	hsa-miR-513a-5p	CLIP-seq
MIRT2096013	hsa-miR-515-3p	CLIP-seq
MIRT2096014	hsa-miR-516b	CLIP-seq
MIRT2096015	hsa-miR-519e	CLIP-seq
MIRT1323407	hsa-miR-520f	CLIP-seq
MIRT2096016	hsa-miR-541	CLIP-seq
MIRT2096017	hsa-miR-544b	CLIP-seq
MIRT1323409	hsa-miR-548a-5p	CLIP-seq
MIRT1323410	hsa-miR-548aa	CLIP-seq
MIRT1323411	hsa-miR-548ab	CLIP-seq
MIRT1323412	hsa-miR-548ak	CLIP-seq
MIRT1323413	hsa-miR-548b-5p	CLIP-seq
MIRT1323414	hsa-miR-548c-3p	CLIP-seq
MIRT1323415	hsa-miR-548c-5p	CLIP-seq
MIRT1323416	hsa-miR-548d-5p	CLIP-seq
MIRT2096018	hsa-miR-548g	CLIP-seq
MIRT1323417	hsa-miR-548h	CLIP-seq
MIRT1323418	hsa-miR-548i	CLIP-seq
MIRT1323419	hsa-miR-548j	CLIP-seq
MIRT1323420	hsa-miR-548k	CLIP-seq
MIRT1323421	hsa-miR-548l	CLIP-seq
MIRT1323423	hsa-miR-548w	CLIP-seq
MIRT1323424	hsa-miR-548y	CLIP-seq
MIRT2096019	hsa-miR-549	CLIP-seq
MIRT2096020	hsa-miR-550a	CLIP-seq
MIRT1323425	hsa-miR-552	CLIP-seq
MIRT1323426	hsa-miR-555	CLIP-seq
MIRT1323427	hsa-miR-556-5p	CLIP-seq
MIRT1323428	hsa-miR-558	CLIP-seq
MIRT1323429	hsa-miR-559	CLIP-seq
MIRT1323430	hsa-miR-570	CLIP-seq
MIRT1323431	hsa-miR-583	CLIP-seq
MIRT1323433	hsa-miR-634	CLIP-seq
MIRT1323434	hsa-miR-635	CLIP-seq
MIRT2096021	hsa-miR-644	CLIP-seq
MIRT2096022	hsa-miR-654-5p	CLIP-seq
MIRT2096023	hsa-miR-663b	CLIP-seq
MIRT2096024	hsa-miR-665	CLIP-seq
MIRT2096025	hsa-miR-668	CLIP-seq
MIRT2096026	hsa-miR-762	CLIP-seq
MIRT2096027	hsa-miR-766	CLIP-seq
MIRT1323440	hsa-miR-885-3p	CLIP-seq
MIRT2096028	hsa-miR-920	CLIP-seq
MIRT1323442	hsa-miR-939	CLIP-seq
MIRT2096029	hsa-miR-940	CLIP-seq
MIRT1323250	hsa-miR-1205	CLIP-seq
MIRT1323251	hsa-miR-1207-3p	CLIP-seq
MIRT1323252	hsa-miR-1207-5p	CLIP-seq
MIRT1323253	hsa-miR-1225-3p	CLIP-seq
MIRT2320303	hsa-miR-1226	CLIP-seq
MIRT1323255	hsa-miR-124	CLIP-seq
MIRT2320304	hsa-miR-1245b-3p	CLIP-seq
MIRT2095900	hsa-miR-1246	CLIP-seq
MIRT2320305	hsa-miR-1256	CLIP-seq
MIRT2320306	hsa-miR-1285	CLIP-seq
MIRT1323262	hsa-miR-130a	CLIP-seq
MIRT1323263	hsa-miR-130b	CLIP-seq
MIRT1323264	hsa-miR-1321	CLIP-seq
MIRT1323265	hsa-miR-1324	CLIP-seq
MIRT2095907	hsa-miR-141	CLIP-seq
MIRT1323268	hsa-miR-145	CLIP-seq
MIRT2320307	hsa-miR-146b-3p	CLIP-seq
MIRT1323270	hsa-miR-148a	CLIP-seq
MIRT1323271	hsa-miR-148b	CLIP-seq
MIRT1323272	hsa-miR-150	CLIP-seq
MIRT1323273	hsa-miR-152	CLIP-seq
MIRT2320308	hsa-miR-155	CLIP-seq
MIRT1323274	hsa-miR-1825	CLIP-seq
MIRT1323277	hsa-miR-191	CLIP-seq
MIRT1323279	hsa-miR-1972	CLIP-seq
MIRT1323280	hsa-miR-199a-5p	CLIP-seq
MIRT1323281	hsa-miR-199b-5p	CLIP-seq
MIRT1323282	hsa-miR-19a	CLIP-seq
MIRT1323283	hsa-miR-19b	CLIP-seq
MIRT2095912	hsa-miR-200a	CLIP-seq
MIRT2095916	hsa-miR-2278	CLIP-seq
MIRT1323291	hsa-miR-301a	CLIP-seq
MIRT1323292	hsa-miR-301b	CLIP-seq
MIRT1323293	hsa-miR-3064-5p	CLIP-seq
MIRT1323294	hsa-miR-3120-3p	CLIP-seq
MIRT1323295	hsa-miR-3121-3p	CLIP-seq
MIRT1323300	hsa-miR-3155	CLIP-seq
MIRT1323301	hsa-miR-3155b	CLIP-seq
MIRT2095924	hsa-miR-3173-3p	CLIP-seq
MIRT2320309	hsa-miR-3173-5p	CLIP-seq
MIRT1323308	hsa-miR-3183	CLIP-seq
MIRT2320310	hsa-miR-3187-5p	CLIP-seq
MIRT1323310	hsa-miR-3189-5p	CLIP-seq
MIRT1556998	hsa-miR-3194-5p	CLIP-seq
MIRT2095928	hsa-miR-3195	CLIP-seq
MIRT2095930	hsa-miR-320a	CLIP-seq
MIRT2095931	hsa-miR-320b	CLIP-seq
MIRT2095932	hsa-miR-320c	CLIP-seq
MIRT2095933	hsa-miR-320d	CLIP-seq
MIRT1323314	hsa-miR-338-3p	CLIP-seq
MIRT2095938	hsa-miR-3591-3p	CLIP-seq
MIRT2095942	hsa-miR-3652	CLIP-seq
MIRT1323319	hsa-miR-3666	CLIP-seq
MIRT2320311	hsa-miR-3692	CLIP-seq
MIRT2095944	hsa-miR-3714	CLIP-seq
MIRT2095946	hsa-miR-3910	CLIP-seq
MIRT1323322	hsa-miR-3918	CLIP-seq
MIRT1323328	hsa-miR-4261	CLIP-seq
MIRT1323329	hsa-miR-4267	CLIP-seq
MIRT1323330	hsa-miR-4269	CLIP-seq
MIRT2095956	hsa-miR-4276	CLIP-seq
MIRT2095959	hsa-miR-4292	CLIP-seq
MIRT1323335	hsa-miR-4295	CLIP-seq
MIRT1323336	hsa-miR-4297	CLIP-seq
MIRT1323337	hsa-miR-4323	CLIP-seq
MIRT1323338	hsa-miR-4324	CLIP-seq
MIRT2320312	hsa-miR-4326	CLIP-seq
MIRT2095966	hsa-miR-4429	CLIP-seq
MIRT2095967	hsa-miR-4430	CLIP-seq
MIRT2095968	hsa-miR-4435	CLIP-seq
MIRT739035	hsa-miR-4436b-3p	CLIP-seq
MIRT1323341	hsa-miR-4438	CLIP-seq
MIRT1323343	hsa-miR-4459	CLIP-seq
MIRT2095973	hsa-miR-4468	CLIP-seq
MIRT2095975	hsa-miR-4490	CLIP-seq
MIRT2095976	hsa-miR-4492	CLIP-seq
MIRT2320313	hsa-miR-4496	CLIP-seq
MIRT2095977	hsa-miR-4498	CLIP-seq
MIRT1323350	hsa-miR-4505	CLIP-seq
MIRT1323351	hsa-miR-4509	CLIP-seq
MIRT1323353	hsa-miR-4512	CLIP-seq
MIRT1323354	hsa-miR-4514	CLIP-seq
MIRT1323356	hsa-miR-454	CLIP-seq
MIRT2320314	hsa-miR-4640-5p	CLIP-seq
MIRT1323357	hsa-miR-4645-5p	CLIP-seq
MIRT1323365	hsa-miR-4673	CLIP-seq
MIRT2095991	hsa-miR-4685-5p	CLIP-seq
MIRT2095992	hsa-miR-4690-3p	CLIP-seq
MIRT1323370	hsa-miR-4692	CLIP-seq
MIRT2095996	hsa-miR-4715-3p	CLIP-seq
MIRT2095997	hsa-miR-4717-5p	CLIP-seq
MIRT1323377	hsa-miR-4723-3p	CLIP-seq
MIRT2320315	hsa-miR-4726-5p	CLIP-seq
MIRT1323378	hsa-miR-4728-5p	CLIP-seq
MIRT1323381	hsa-miR-4733-3p	CLIP-seq
MIRT2096000	hsa-miR-4738-5p	CLIP-seq
MIRT1323382	hsa-miR-4739	CLIP-seq
MIRT1323384	hsa-miR-4744	CLIP-seq
MIRT1323389	hsa-miR-4756-5p	CLIP-seq
MIRT1323391	hsa-miR-4763-3p	CLIP-seq
MIRT1323392	hsa-miR-4766-5p	CLIP-seq
MIRT1323394	hsa-miR-4779	CLIP-seq
MIRT1323395	hsa-miR-4793-5p	CLIP-seq
MIRT2096007	hsa-miR-483-3p	CLIP-seq
MIRT1323397	hsa-miR-484	CLIP-seq
MIRT1323399	hsa-miR-506	CLIP-seq
MIRT2096012	hsa-miR-508-5p	CLIP-seq
MIRT1323404	hsa-miR-512-5p	CLIP-seq
MIRT1323405	hsa-miR-513a-5p	CLIP-seq
MIRT2096017	hsa-miR-544b	CLIP-seq
MIRT1323409	hsa-miR-548a-5p	CLIP-seq
MIRT1323410	hsa-miR-548aa	CLIP-seq
MIRT1323411	hsa-miR-548ab	CLIP-seq
MIRT1323412	hsa-miR-548ak	CLIP-seq
MIRT1323413	hsa-miR-548b-5p	CLIP-seq
MIRT1323414	hsa-miR-548c-3p	CLIP-seq
MIRT1323415	hsa-miR-548c-5p	CLIP-seq
MIRT1323416	hsa-miR-548d-5p	CLIP-seq
MIRT1323417	hsa-miR-548h	CLIP-seq
MIRT1323418	hsa-miR-548i	CLIP-seq
MIRT1323419	hsa-miR-548j	CLIP-seq
MIRT1323420	hsa-miR-548k	CLIP-seq
MIRT1323421	hsa-miR-548l	CLIP-seq
MIRT1323423	hsa-miR-548w	CLIP-seq
MIRT1323424	hsa-miR-548y	CLIP-seq
MIRT1323429	hsa-miR-559	CLIP-seq
MIRT1323430	hsa-miR-570	CLIP-seq
MIRT2320316	hsa-miR-576-5p	CLIP-seq
MIRT2320317	hsa-miR-612	CLIP-seq
MIRT1323433	hsa-miR-634	CLIP-seq
MIRT1323437	hsa-miR-664	CLIP-seq
MIRT2096025	hsa-miR-668	CLIP-seq
MIRT2096026	hsa-miR-762	CLIP-seq
MIRT2320318	hsa-miR-874	CLIP-seq
MIRT2096029	hsa-miR-940	CLIP-seq
MIRT2320309	hsa-miR-3173-5p	CLIP-seq
MIRT2095938	hsa-miR-3591-3p	CLIP-seq
MIRT2095944	hsa-miR-3714	CLIP-seq
MIRT1323327	hsa-miR-4252	CLIP-seq
MIRT739035	hsa-miR-4436b-3p	CLIP-seq
MIRT1323346	hsa-miR-4476	CLIP-seq
MIRT1323358	hsa-miR-4646-5p	CLIP-seq
MIRT1323369	hsa-miR-4691-3p	CLIP-seq
MIRT1323385	hsa-miR-4747-5p	CLIP-seq
MIRT1323396	hsa-miR-4795-5p	CLIP-seq
MIRT739035	hsa-miR-4436b-3p	CLIP-seq
MIRT739035	hsa-miR-4436b-3p	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
NR1I2	Unknown	21295138

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	17426122
GO:0000785	Component	Chromatin	IDA	9267036
GO:0000785	Component	Chromatin	IDA	18511497, 25592151
GO:0000785	Component	Chromatin	ISA
GO:0000976	Function	Transcription cis-regulatory region binding	IDA	18511497
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IDA	7831303
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	12037571
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001221	Function	Transcription coregulator binding	IPI	14701856
GO:0001972	Function	Retinoic acid binding	IDA	18690216, 19043829
GO:0002157	Process	Positive regulation of thyroid hormone receptor signaling pathway	IDA	1310350, 26289479
GO:0003677	Function	DNA binding	IEA
GO:0003690	Function	Double-stranded DNA binding	IMP	19043829
GO:0003700	Function	DNA-binding transcription factor activity	IDA	12037571, 17426122
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0003707	Function	Nuclear steroid receptor activity	IEA
GO:0004879	Function	Nuclear receptor activity	IBA
GO:0004879	Function	Nuclear receptor activity	IDA	1651173, 7990953, 9267036, 9568716, 20219900, 25592151
GO:0004879	Function	Nuclear receptor activity	TAS	1310260
GO:0005515	Function	Protein binding	IPI	9653119, 10428834, 10866662, 11915042, 12040021, 15722453, 16769902, 17363140, 17426122, 17641689, 17673910, 17947383, 19047629, 19345331, 19786558, 19917671, 20211142, 20219900, 20541701, 20682316, 21220114, 21478865, 21988832, 22179700, 22474364, 23602807, 24561505, 25241761, 2530
GO:0005634	Component	Nucleus	IDA	7990953, 19917671
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005667	Component	Transcription regulator complex	IPI	10698945, 20682316, 21152046, 23602807, 26820900
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0007399	Process	Nervous system development	IBA
GO:0008270	Function	Zinc ion binding	IDA	19043829
GO:0008270	Function	Zinc ion binding	IEA
GO:0009755	Process	Hormone-mediated signaling pathway	IDA	7744246
GO:0009755	Process	Hormone-mediated signaling pathway	ISS
GO:0010875	Process	Positive regulation of cholesterol efflux	TAS	23990020
GO:0019899	Function	Enzyme binding	IPI	12039952
GO:0030154	Process	Cell differentiation	IBA
GO:0030224	Process	Monocyte differentiation	IDA	9568716
GO:0030501	Process	Positive regulation of bone mineralization	NAS	27184385
GO:0030518	Process	Nuclear receptor-mediated steroid hormone signaling pathway	IEA
GO:0032526	Process	Response to retinoic acid	IMP	17538076
GO:0035357	Process	Peroxisome proliferator activated receptor signaling pathway	IDA	9568716, 10195690
GO:0042277	Function	Peptide binding	IDA	19043829
GO:0042789	Process	MRNA transcription by RNA polymerase II	IDA	1309942, 1310350, 1310351, 7744246, 20171278, 26289479
GO:0042789	Process	MRNA transcription by RNA polymerase II	ISS
GO:0042789	Process	MRNA transcription by RNA polymerase II	NAS	9430642
GO:0042802	Function	Identical protein binding	IPI	7831303
GO:0042809	Function	Nuclear vitamin D receptor binding	IPI	17426122
GO:0043235	Component	Receptor complex	IDA	17426122, 19043829
GO:0043565	Function	Sequence-specific DNA binding	IDA	11915042
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0044323	Function	Retinoic acid-responsive element binding	IBA
GO:0044323	Function	Retinoic acid-responsive element binding	IDA	19917671, 25592151
GO:0045834	Process	Positive regulation of lipid metabolic process	TAS	9568716
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	1651173
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IBA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	9568716
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	12037571
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	1309942, 1310350, 7744246, 9430642, 20171278, 20219900, 25592151, 26289479
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	ISS
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	NAS	23602807
GO:0046872	Function	Metal ion binding	IEA
GO:0048384	Process	Retinoic acid receptor signaling pathway	IBA
GO:0048384	Process	Retinoic acid receptor signaling pathway	IDA	9267036, 19917671
GO:0048384	Process	Retinoic acid receptor signaling pathway	IDA	1309942, 9267036
GO:0048384	Process	Retinoic acid receptor signaling pathway	IMP	17538076
GO:0048469	Process	Cell maturation	IDA	9568716
GO:0050692	Function	DNA binding domain binding	IDA	19043829
GO:0050693	Function	LBD domain binding	IDA	19043829
GO:0070564	Process	Positive regulation of vitamin D receptor signaling pathway	IDA	20171278
GO:0070644	Function	Vitamin D response element binding	IDA	17426122
GO:0071404	Process	Cellular response to low-density lipoprotein particle stimulus	IDA	9568716
GO:0071630	Process	Nuclear protein quality control by the ubiquitin-proteasome system	IDA	37478846
GO:0090575	Component	RNA polymerase II transcription regulator complex	EXP	19167885, 22474364
GO:0090575	Component	RNA polymerase II transcription regulator complex	IBA
GO:0090575	Component	RNA polymerase II transcription regulator complex	IDA	1310351, 9568716, 17426122, 18511497, 26289479
GO:0090575	Component	RNA polymerase II transcription regulator complex	IPI	10669605, 22179700
GO:0090575	Component	RNA polymerase II transcription regulator complex	ISS
GO:0090575	Component	RNA polymerase II transcription regulator complex	NAS	9430642
GO:0140077	Process	Positive regulation of lipoprotein transport	IDA	9568716
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

Other IDs

• MIM: 180245
• HGNC: 10477
• e!Ensembl: ENSG00000186350

Protein

• UniProt ID: P19793
• Protein name: Retinoic acid receptor RXR-alpha (Nuclear receptor subfamily 2 group B member 1) (Retinoid X receptor alpha)
• Protein function: Receptor for retinoic acid that acts as a transcription factor (PubMed:10874028, PubMed:11162439, PubMed:11915042, PubMed:37478846). Forms homo- or heterodimers with retinoic acid receptors (RARs) and binds to target response elements in respons
• PDB: 1BY4, 1DSZ, 1FBY, 1FM6, 1FM9, 1G1U, 1G5Y, 1K74, 1MV9, 1MVC, 1MZN, 1R0N, 1RDT, 1RXR, 1XLS, 1XV9, 1XVP, 1YNW, 2ACL, 2NLL, 2P1T, 2P1U, 2P1V, 2ZXZ, 2ZY0, 3DZU, 3DZY, 3E00, 3E94, 3FAL, 3FC6, 3FUG, 3H0A, 3KWY, 3NSP, 3NSQ, 3OAP, 3OZJ, 3PCU, 3R29, 3R2A, 3R5M, 3UVV, 4CN2, 4CN3, 4CN5, 4CN7, 4J5W, 4J5X, 4K4J, 4K6I
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF11825	Nuc_recep-AF1	17 → 127	Nuclear/hormone receptor activator site AF-1	Family
  PF00105	zf-C4	133 → 202	Zinc finger, C4 type (two domains)	Domain
  PF00104	Hormone_recep	257 → 442	Ligand-binding domain of nuclear hormone receptor	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in lung fibroblasts (at protein level) (PubMed:30216632). Expressed in monocytes (PubMed:26463675). Highly expressed in liver, also found in kidney and brain (PubMed:14702039, PubMed:2159111, PubMed:24275569). {ECO:0000269|Pu
• Sequence:

  MDTKHFLPLDFSTQVNSSLTSPTGRGSMAAPSLHPSLGPGIGSPGQLHSPISTLSSPING
  MGPPFSVISSPMGPHSMSVPTTPTLGFSTGSPQLSSPMNPVSSSEDIKPPLGLNGVLKVP
  AHPSGNMASFTKHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCLID
  KRQRNRCQYCRYQKCLAMGMKREAVQEERQRGKDRNENEVESTSSANEDMPVERILEAEL
  AVEPKTETYVEANMGLNPSSPNDPVTNICQAADKQLFTLVEWAKRIPHFSELPLDDQVIL
  LRAGWNELLIASFSHRSIAVKDGILLATGLHVHRNSAHSAGVGAIFDRVLTELVSKMRDM
  QMDKTELGCLRAIVLFNPDSKGLSNPAEVEALREKVYASLEAYCKHKYPEQPGRFAKLLL
  RLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQMT

• Sequence length: 462

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Multiple myeloma	Likely pathogenic	rs1588299621	RCV000984088	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
AMYOTROPHIC LATERAL SCLEROSIS 1	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGENITAL HEART DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORNEAL DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORNEAL DYSTROPHY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EYE DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KERATOCONUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MESOTHELIOMA, MALIGNANT	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOTOR NEURON DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PELVIC ORGAN PROLAPSE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERICARDITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
THYROID NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute Cerebrovascular Accidents	Stroke	BEFREE	24368200		★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	15121864, 18408763, 25510432		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	CLINVAR_DG	26619011		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of prostate	Prostate adenocarcinoma	BEFREE	15006913		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	23639973		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	19374686	Associate	★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	26026644, 26080426, 29995422		★☆☆☆☆ Found in Text Mining only
AMYOTROPHIC LATERAL SCLEROSIS 1	Lateral Sclerosis	CTD_human_DG	11796754		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Amyotrophic Lateral Sclerosis, Familial	Amyotrophic lateral sclerosis	CTD_human_DG	11796754		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis, Sporadic	Lateral Sclerosis	CTD_human_DG	11796754		★☆☆☆☆ Found in Text Mining only
Aniridia	Aniridia	Pubtator	34827649	Associate	★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	29459264, 30943581		★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	28335003, 29848990	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	14534304, 36613720	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	24391011	Inhibit	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	29459264, 30943581		★☆☆☆☆ Found in Text Mining only
ATRICHIA WITH PAPULAR LESIONS	Atrichia With Papular Lesions	BEFREE	15121864		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	28335003	Associate	★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	26901314, 29143738		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	10336422, 15082790, 22949521, 23180655, 26275572, 26488576		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	12841681, 15082790, 15318936, 18565212, 19644018, 23180655, 25013807, 25328014, 25778982, 25833198, 26310932, 27530324, 30857277, 33478016, 34239022, 35406808, 36930833, 9343423	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	28427429	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	22205725, 22948024, 24103747, 26156677	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	23639973		★☆☆☆☆ Found in Text Mining only
Carcinoma Adenoid Cystic	Adenoid cystic carcinoma	Pubtator	37040084	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal Breast	Ductal carcinoma of breast	Pubtator	18565212	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	17604322, 17900311, 23317196, 23690070, 24103747, 34861383, 35712812	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	11092983	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	26901314, 29143738		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	11212249, 31305128		★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	19753122	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	11077050	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	37542511	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Hypertrophic	Hypertrophic cardiomyopathy	Pubtator	33757590	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	33055159	Associate	★☆☆☆☆ Found in Text Mining only
Carotid Artery Diseases	Carotid artery disease	Pubtator	21709632	Associate	★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	Pubtator	21709632	Associate	★☆☆☆☆ Found in Text Mining only
CATARACT, MARNER TYPE	Cataract	BEFREE	19279199		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	26310932	Associate	★☆☆☆☆ Found in Text Mining only
Cholestasis	Cholelithiasis	Pubtator	25798860	Associate	★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	BEFREE	19133314, 21673049		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	29995422		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	14670614, 28465486, 28846104, 30931933		★☆☆☆☆ Found in Text Mining only
Colonic Diseases	Colonic disease	Pubtator	20145122	Associate	★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	25171473	Associate	★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	27167203	Inhibit	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	20558521, 21561764		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	12771132, 17604322, 18196974, 20558521, 22108803, 25171473, 26450852, 27167203, 29740162, 33472949, 37246895, 7883226	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	20558521	Stimulate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	30931933		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	19753122		★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	20855565	Associate	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	20855565, 26768185		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	28335003	Associate	★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	BEFREE	26575331		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	33050003	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Complications	Diabetes complications	Pubtator	22180072	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	27636996, 34633445	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	9065481	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	14534304, 22023374, 29057944	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	21284483, 22023374, 29057944		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	22180072	Associate	★☆☆☆☆ Found in Text Mining only
DiGeorge Syndrome	Digeorge syndrome	Pubtator	35940635	Associate	★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	BEFREE	22896670, 31775661		★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	Pubtator	22896670	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	22205725	Associate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	31119261		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	29661715		★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	32194853	Associate	★☆☆☆☆ Found in Text Mining only
Esophagitis	Esotropia	Pubtator	11315258	Associate	★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty liver	Pubtator	25948673	Associate	★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	BEFREE	17170071		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	24832862		★☆☆☆☆ Found in Text Mining only
Follicular adenoma	Adenoma	BEFREE	23639973		★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	27167107	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	Pubtator	26610845	Associate	★☆☆☆☆ Found in Text Mining only
Granulomatosis with Polyangiitis	Granulomatosis with polyangiitis	Pubtator	25939343	Associate	★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	36902107	Associate	★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	32154187	Associate	★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	12149223	Associate	★☆☆☆☆ Found in Text Mining only
Hemolytic Uremic Syndrome	Hemolytic uremic syndrome	Pubtator	40108621	Inhibit	★☆☆☆☆ Found in Text Mining only
Hepatolenticular Degeneration	Hepatolenticular Degeneration	BEFREE	30709419		★☆☆☆☆ Found in Text Mining only
Hepatolenticular Degeneration	Hepatolenticular degeneration	Pubtator	30709419	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	11092983	Associate	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	27449397, 31775661		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	27449397, 31775661		★☆☆☆☆ Found in Text Mining only
Hyperaldosteronism	Hyperaldosteronism	Pubtator	27777363	Associate	★☆☆☆☆ Found in Text Mining only
Hyperlipoproteinemias	Hyperlipoproteinemia	Pubtator	22023374	Associate	★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	21709632	Inhibit	★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	22023374	Associate	★☆☆☆☆ Found in Text Mining only
Hypertriglyceridemia	Hypertriglyceridemia	Pubtator	12519787	Associate	★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	Pubtator	10194237, 37563580	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	32978975	Inhibit	★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	29995422		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	28335003, 35275975	Associate	★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Intellectual developmental disorder	Pubtator	29769320	Associate	★☆☆☆☆ Found in Text Mining only
Iron Overload	Iron overload	Pubtator	21114893	Stimulate	★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	BEFREE	24265017, 25675348		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Keratoconus	Keratoconus	Pubtator	26040312	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Diseases	Kidney disease	Pubtator	36443310	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	29991691	Associate	★☆☆☆☆ Found in Text Mining only
Lesion of Sciatic Nerve	Lesion Of Sciatic Nerve	CTD_human_DG	16782282		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	10601023, 8634447	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	LHGDN	18239067		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	18408763		★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	10068679, 11756188, 15026318, 16946489, 30225259, 8530518, 8634447	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	23823656, 32434928	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Promyelocytic leukemia	Pubtator	10601023, 10979971, 20159609, 8634447	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	24723466		★☆☆☆☆ Found in Text Mining only
Liposarcoma	Liposarcoma	Pubtator	8990192	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	11606411, 12807734, 30477453		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CLINVAR_DG	26619011		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Biliary	Liver cirrhosis	Pubtator	30528300	Associate	★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	35246921	Associate	★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	17272513	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	11839661		★☆☆☆☆ Found in Text Mining only
Lymphohistiocytosis Hemophagocytic	Hemophagocytic lymphohistiocytosis	Pubtator	21325597	Associate	★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	26883505	Associate	★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	CTD_human_DG	25756049		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	10336422, 15082790, 22949521, 23180655, 26275572, 26488576		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	31305128		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	23826131		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	15006913		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	15318950		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	26901314, 29143738		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	15140235, 22545132, 29228308, 29661715, 30931933		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	14670614, 28465486, 28846104, 30931933		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	15082790		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	25189354, 26575331, 29121869		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	30200275, 9228081	Associate	★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	26575331	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	22140563	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	24060638	Inhibit	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	29057944	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	22475777, 29057944		★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	BEFREE	21673049		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	25669983	Associate	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Mycosis Fungoides	Mycosis fungoides	Pubtator	33299887	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	30413149	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11606411, 15006913, 17170071, 20145122, 26275572, 29121869, 29661715		★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic syndrome	Pubtator	26610845	Associate	★☆☆☆☆ Found in Text Mining only
Neuralgia-Neuritis, Sciatic Nerve	Sciatic Nerve Neuralgia-Neuritis	CTD_human_DG	16782282		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	28627642		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	26883505, 33187070	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	28089347		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	22023374, 22205725, 29454501	Associate	★☆☆☆☆ Found in Text Mining only
Oligodendroglioma	Oligodendroglioma	Pubtator	8798469	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	24286485	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	12006550	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	31865146, 38143770	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	23826131		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	23826131, 28573829, 31210298	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	28348207		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	31245852		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	31173497	Associate	★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	15006913		★☆☆☆☆ Found in Text Mining only
Prostatic Intraepithelial Neoplasias	Prostatic Neoplasms	BEFREE	15006913		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	15318950		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	18162523		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Refractory anemias	Anemia	BEFREE	29246089		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	19753122		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	Pubtator	9260893	Associate	★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	Pubtator	25915942	Associate	★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	29246089		★☆☆☆☆ Found in Text Mining only
Sciatic Nerve Palsy	Sciatic Nerve Palsy	CTD_human_DG	16782282		★☆☆☆☆ Found in Text Mining only
Sciatic Neuritis	Sciatic Neuritis	CTD_human_DG	16782282		★☆☆☆☆ Found in Text Mining only
Sciatic Neuropathy	Sciatic Neuropathy	CTD_human_DG	16782282		★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary syndrome	Pubtator	15245439	Associate	★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	19404300	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	15255287		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	10738115	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	29228308		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	26898458		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	11044367, 12970875, 22901127, 23605322	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	26898458	Stimulate	★☆☆☆☆ Found in Text Mining only
Tetralogy of Fallot	Tetralogy of Fallot	BEFREE	24513686		★☆☆☆☆ Found in Text Mining only
Thyroid cancer follicular	Follicular thyroid cancer	Pubtator	33009242	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	23639973		★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	CTD_human_DG	23811263		★☆☆☆☆ Found in Text Mining only
Thyroid Gland Follicular Adenoma	Thyroid Gland Follicular Adenoma	CTD_human_DG	23811263		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	CTD_human_DG	23811263		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	26310932	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid Neoplasms	Thyroid cancer	Pubtator	33009242	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Transitional cell carcinoma of bladder	Bladder carcinoma	CLINVAR_DG	26619011		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	30518934		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	26901314, 30651555	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	21736279	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	17170071		★☆☆☆☆ Found in Text Mining only
Vasospasm Intracranial	Intracranial vasospasm	Pubtator	31595394	Associate	★☆☆☆☆ Found in Text Mining only
Vitamin A Deficiency	Vitamin A Deficiency	BEFREE	29089448		★☆☆☆☆ Found in Text Mining only
Vitamin D Deficiency	Vitamin d deficiency	Pubtator	25171473	Associate	★☆☆☆☆ Found in Text Mining only