RWDD3 (RWD domain containing 3)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 25950
• Gene name: RWD domain containing 3
• Gene symbol: RWDD3
• Synonyms (NCBI Gene): RSUME
• Chromosome: 1
• Chromosome location: 1p21.3

miRNA Show/Hide all (50)

miRTarBase ID	miRNA	Experiments	Reference
MIRT1323204	hsa-miR-1206	CLIP-seq
MIRT1323205	hsa-miR-4255	CLIP-seq
MIRT1323206	hsa-miR-4729	CLIP-seq
MIRT1323207	hsa-miR-513a-3p	CLIP-seq
MIRT1323208	hsa-miR-579	CLIP-seq
MIRT2616263	hsa-miR-1200	CLIP-seq
MIRT2616264	hsa-miR-1322	CLIP-seq
MIRT2616265	hsa-miR-1343	CLIP-seq
MIRT2616266	hsa-miR-300	CLIP-seq
MIRT2616267	hsa-miR-3074-5p	CLIP-seq
MIRT2616268	hsa-miR-3119	CLIP-seq
MIRT2616269	hsa-miR-3124-3p	CLIP-seq
MIRT2616270	hsa-miR-3128	CLIP-seq
MIRT2616271	hsa-miR-3140-3p	CLIP-seq
MIRT2616272	hsa-miR-3140-5p	CLIP-seq
MIRT2616273	hsa-miR-3614-3p	CLIP-seq
MIRT2616274	hsa-miR-375	CLIP-seq
MIRT2616275	hsa-miR-381	CLIP-seq
MIRT2616276	hsa-miR-3919	CLIP-seq
MIRT2616277	hsa-miR-3977	CLIP-seq
MIRT2616278	hsa-miR-4326	CLIP-seq
MIRT2616279	hsa-miR-4470	CLIP-seq
MIRT2616280	hsa-miR-4659a-3p	CLIP-seq
MIRT2616281	hsa-miR-4659b-3p	CLIP-seq
MIRT2616282	hsa-miR-4666-3p	CLIP-seq
MIRT2616283	hsa-miR-4670-3p	CLIP-seq
MIRT2616284	hsa-miR-4756-3p	CLIP-seq
MIRT2616285	hsa-miR-889	CLIP-seq
MIRT2616286	hsa-miR-892b	CLIP-seq
MIRT2616263	hsa-miR-1200	CLIP-seq
MIRT2616264	hsa-miR-1322	CLIP-seq
MIRT2616265	hsa-miR-1343	CLIP-seq
MIRT2616266	hsa-miR-300	CLIP-seq
MIRT2616267	hsa-miR-3074-5p	CLIP-seq
MIRT2616268	hsa-miR-3119	CLIP-seq
MIRT2616269	hsa-miR-3124-3p	CLIP-seq
MIRT2616270	hsa-miR-3128	CLIP-seq
MIRT2616271	hsa-miR-3140-3p	CLIP-seq
MIRT2616272	hsa-miR-3140-5p	CLIP-seq
MIRT2616273	hsa-miR-3614-3p	CLIP-seq
MIRT2616274	hsa-miR-375	CLIP-seq
MIRT2616275	hsa-miR-381	CLIP-seq
MIRT2616278	hsa-miR-4326	CLIP-seq
MIRT2616279	hsa-miR-4470	CLIP-seq
MIRT2616280	hsa-miR-4659a-3p	CLIP-seq
MIRT2616281	hsa-miR-4659b-3p	CLIP-seq
MIRT2616282	hsa-miR-4666-3p	CLIP-seq
MIRT2616283	hsa-miR-4670-3p	CLIP-seq
MIRT2616285	hsa-miR-889	CLIP-seq
MIRT2616286	hsa-miR-892b	CLIP-seq

Gene ontology (GO) Show/Hide all (8)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	17956732, 23469069
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0032088	Process	Negative regulation of NF-kappaB transcription factor activity	IDA	23469069
GO:0033235	Process	Positive regulation of protein sumoylation	IDA	23469069
GO:0033235	Process	Positive regulation of protein sumoylation	IEA
GO:1902073	Process	Positive regulation of hypoxia-inducible factor-1alpha signaling pathway	IDA	23469069
GO:1902073	Process	Positive regulation of hypoxia-inducible factor-1alpha signaling pathway	IEA

Other IDs

• MIM: 615875
• HGNC: 21393
• e!Ensembl: ENSG00000122481

Protein

• UniProt ID: Q9Y3V2
• Protein name: RWD domain-containing protein 3 (RWD domain-containing sumoylation enhancer) (RSUME)
• Protein function: Enhancer of SUMO conjugation. Via its interaction with UBE2I/UBC9, increases SUMO conjugation to proteins by promoting the binding of E1 and E2 enzymes, thioester linkage between SUMO and UBE2I/UBC9 and transfer of SUMO to specific target protei
• PDB: 2EBK , 4Y1L
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF05773	RWD	3 → 111	RWD domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Isoform 1 and isoform 2 are expressed in glioma tumors (at protein level). Expressed in a wide number of tissues with highest expression in cerebellum, pituitary, heart, kidney, liver, stomach, pancreas, prostate and spleen. Low levels
• Sequence:

  MAEPVQEELSVLAAIFCRPHEWEVLSRSETDGTVFRIHTKAEGFMDVDIPLELVFHLPVN
  YPSCLPGISINSEQLTRAQCVTVKENLLEQAESLLSEPMVHELVLWIQQNLRHILSQPET
  GSGSEKCTFSTSTTMDDGLWITLLHLDHMRAKTKYVKIVEKWASDLRLTGRLMFMGKIIL
  ILLQGDRNNLKEYLILQKTSKVDVDSSGKKCKEKMISVLFETKVQTEHKRFLAFEVKEYS
  ALDELQKEFETAGLKKLFSEFVLALVK

• Sequence length: 267

Pathways

Reactome Pathway:

SUMO is transferred from E1 to E2 (UBE2I, UBC9)

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
OBSESSIVE-COMPULSIVE DISORDER	—	GWAS catalog	37094658	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (16)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	BEFREE	25500545		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	24098497	Associate	★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	25500545, 30890701		★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	37330465	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	29977365		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	29977365		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	29436665		★☆☆☆☆ Found in Text Mining only
Hemangioblastoma	Hemangioblastoma	BEFREE	25500545		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	37925421	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial ischemia	Pubtator	34768754	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	25500545, 29436665, 30890701		★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	BEFREE	25500545		★☆☆☆☆ Found in Text Mining only
Prolactinoma	Prolactinoma	BEFREE	19407504		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	30890701		★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	34031191	Associate	★☆☆☆☆ Found in Text Mining only
Von Hippel-Lindau Syndrome	Von Hippel-Lindau Syndrome	BEFREE	25500545		★☆☆☆☆ Found in Text Mining only

Related Genes

No strongly related genes found yet for RWDD3.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to RWDD3.