RTRAF (RNA transcription, translation and transport factor)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene Gene ontology Other IDs Protein Pathways Related genes Diseases linked via similar genes

Gene

• Entrez ID: 51637
• Gene name: RNA transcription, translation and transport factor
• Gene symbol: RTRAF
• Synonyms (NCBI Gene): C14orf166, CGI-99, CGI99, CLE, CLE7, LCRP369, RLLM1, hCLE, hCLE1
• Chromosome: 14
• Chromosome location: 14q22.1

Gene ontology (GO) Show/Hide all (31)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000993	Function	RNA polymerase II complex binding	IDA	16950395
GO:0003723	Function	RNA binding	HDA	22658674
GO:0003723	Function	RNA binding	IBA
GO:0003723	Function	RNA binding	IDA	24608264
GO:0003723	Function	RNA binding	IEA
GO:0005515	Function	Protein binding	IPI	11507205, 15147888, 21994455, 24608264, 25416956, 28040436, 30021884, 30833792, 31515488, 32296183, 33961781, 35271311
GO:0005634	Component	Nucleus	IDA	15147888, 24608264
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	NAS	21311021
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IDA	24608264
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	NAS	21311021
GO:0005813	Component	Centrosome	IDA	15147888
GO:0005813	Component	Centrosome	IEA
GO:0005829	Component	Cytosol	IEA
GO:0005856	Component	Cytoskeleton	IEA
GO:0006388	Process	TRNA splicing, via endonucleolytic cleavage and ligation	IBA
GO:0006388	Process	TRNA splicing, via endonucleolytic cleavage and ligation	IMP	24870230
GO:0006388	Process	TRNA splicing, via endonucleolytic cleavage and ligation	NAS	24870230
GO:0006469	Process	Negative regulation of protein kinase activity	IMP	15147888
GO:0042802	Function	Identical protein binding	IPI	15147888, 24608264
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	16950395
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	15147888
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0050658	Process	RNA transport	TAS	24608264
GO:0072669	Component	TRNA-splicing ligase complex	IBA
GO:0072669	Component	TRNA-splicing ligase complex	IDA	21311021, 24870230
GO:0072669	Component	TRNA-splicing ligase complex	NAS	24870230
GO:0072686	Component	Mitotic spindle	IDA	15147888

Other IDs

• MIM: 610858
• HGNC: 23169
• e!Ensembl: ENSG00000087302

Protein

• UniProt ID: Q9Y224
• Protein name: RNA transcription, translation and transport factor protein (CLE7 homolog) (CLE) (hCLE)
• Protein function: RNA-binding protein involved in modulation of mRNA transcription by Polymerase II (PubMed:16950395). Component of the tRNA-splicing ligase complex and is required for tRNA ligation (PubMed:24870230). May be required for RNA transport (PubMed:246
• PDB: 7P3A
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF10036	RLL	2 → 244	RNA transcription, translation and transport factor protein	Family

• Tissue specificity: TISSUE SPECIFICITY: Widely expressed. Expressed at high level in heart and skeletal muscle. Expressed at intermediate level in liver, pancreas, fetal brain and fetal lung. Weakly expressed in adult brain, adult lung, placenta, fetal liver and fetal kidney
• Sequence:

  MFRRKLTALDYHNPAGFNCKDETEFRNFIVWLEDQKIRHYKIEDRGNLRNIHSSDWPKFF
  EKYLRDVNCPFKIQDRQEAIDWLLGLAVRLEYGDNAEKYKDLVPDNSKTADNATKNAEPL
  INLDVNNPDFKAGVMALANLLQIQRHDDYLVMLKAIRILVQERLTQDAVAKANQTKEGLP
  VALDKHILGFDTGDAVLNEAAQILRLLHIEELRELQTKINEAIVAVQAIIADPKTDHRLG
  KVGR

• Sequence length: 244

Pathways

Reactome Pathway:

tRNA processing in the nucleus

Related Genes

No strongly related genes found yet for RTRAF.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to RTRAF.