RTP2 (receptor transporter protein 2)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 344892
Gene name Receptor transporter protein 2
Gene symbol RTP2
Synonyms (NCBI Gene)
Z3CXXC2
Chromosome 3
Chromosome location 3q27.3
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
13 Show/Hide all (13)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0001580 Process Detection of chemical stimulus involved in sensory perception of bitter taste IBA
GO:0005515 Function Protein binding IPI 25416956, 32296183
GO:0005886 Component Plasma membrane IEA
GO:0006612 Process Protein targeting to membrane IBA
GO:0008270 Function Zinc ion binding IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
609138 32486 ENSG00000198471
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q5QGT7
Protein name Receptor-transporting protein 2 (3CxxC-type zinc finger protein 2)
Protein function Specifically promotes functional cell surface expression of olfactory receptors, but not of other GPCRs.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13695 zf-3CxxC 51 → 161 Zinc-binding domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in circumvallate papillae and testis. {ECO:0000269|PubMed:16720576}.
Sequence 
MCTSLTTCEWKKVFYEKMEVAKPADSWELIIDPNLKPSELAPGWKQYLEQHASGRFHCSW
CWHTWQSAHVVILFHMFLDRAQRAGSVRMRVFKQLCYECGTARLDESSMLEENIEGLVDN
LITSLREQCYEEDGGQYRIHVASRPDSGPHRAEFCEACQEGIVHWKPSEKLLEEEVTTYT
SEASKPRAQAGSGYNFLSLRWCLFWASLCLLVVYLQFSFLSPAFF
Sequence length 225
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
Reactome Pathway
Olfactory Signaling Pathway

No strongly related genes found yet for RTP2.

No additional diseases found yet through genes similar to RTP2.