RTL4 (retrotransposon Gag like 4)

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 340595
Gene name Retrotransposon Gag like 4
Gene symbol RTL4
Synonyms (NCBI Gene)
Mar4Mart4SIRH1SIRH11ZCCHC16
Chromosome X
Chromosome location Xq23
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
6 Show/Hide all (6)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0003676 Function Nucleic acid binding IEA
GO:0005515 Function Protein binding IPI 32296183
GO:0008270 Function Zinc ion binding IEA
GO:0042415 Process Norepinephrine metabolic process IEA
GO:0046872 Function Metal ion binding IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
301131 25214 ENSG00000187823
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q6ZR62
Protein name Retrotransposon Gag-like protein 4 (Mammalian retrotransposon-derived protein 4) (Zinc finger CCHC domain-containing protein 16)
Protein function Involved in cognitive function in the brain, possibly via the noradrenergic system.
Family and domains
Sequence 
MEKCTKSSSTMQVEPSFLQAENLILRLQMQHPTTENTAKRGQVMPALATTVMPVPYSLEH
LTQFHGDPANCSEFLTQVTTYLTALQISNPANDAQIKLFFDYLSQQLESCGIISGPDKST
LLKQYENLILEFQQSFGKPTKQEINPLMNAKFDKGDNSSQQDPATFHLLAQNLICNETNQ
SGQFEKALADPNQDEESVTDMMDNLPDLITQCIQLDKKHSDRPELLQSETQLPLLASLIQ
HQALFSPTDPPPKKGPIQLREGQLPLTPAKRARQQETQLCLYCSQSGHFTRDCLAKRSRA
PATTNNTAHQ
Sequence length 310
Interactions View interactions

No strongly related genes found yet for RTL4.

No additional diseases found yet through genes similar to RTL4.