Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	6242
Gene name	Rhotekin
Gene symbol	RTKN
Synonyms (NCBI Gene)	RTKN-1
Chromosome	2
Chromosome location	2p13.1
Summary	This gene encodes a scaffold protein that interacts with GTP-bound Rho proteins. Binding of this protein inhibits the GTPase activity of Rho proteins. This protein may interfere with the conversion of active, GTP-bound Rho to the inactive GDP-bound form b

119 Show/Hide all (119)

miRTarBase ID	miRNA	Experiments	Reference
MIRT021499	hsa-miR-145-5p	Reporter assay;Western blot;qRT-PCR;Other	19360360
MIRT036220	hsa-miR-320b	CLASH	23622248
MIRT036125	hsa-miR-1296-5p	CLASH	23622248
MIRT496917	hsa-miR-193a-3p	PAR-CLIP	22291592
MIRT496916	hsa-miR-193b-3p	PAR-CLIP	22291592
MIRT496915	hsa-miR-4524b-3p	PAR-CLIP	22291592
MIRT496914	hsa-miR-4463	PAR-CLIP	22291592
MIRT496913	hsa-miR-4494	PAR-CLIP	22291592
MIRT496912	hsa-miR-3190-5p	PAR-CLIP	22291592
MIRT496911	hsa-miR-3926	PAR-CLIP	22291592
MIRT496910	hsa-miR-548s	PAR-CLIP	22291592
MIRT489925	hsa-miR-4323	PAR-CLIP	23592263
MIRT489924	hsa-miR-6760-5p	PAR-CLIP	23592263
MIRT489923	hsa-miR-1321	PAR-CLIP	23592263
MIRT489922	hsa-miR-4739	PAR-CLIP	23592263
MIRT489920	hsa-miR-4756-5p	PAR-CLIP	23592263
MIRT489921	hsa-miR-1225-3p	PAR-CLIP	23592263
MIRT489919	hsa-miR-6799-5p	PAR-CLIP	23592263
MIRT489918	hsa-miR-629-5p	PAR-CLIP	23592263
MIRT489917	hsa-miR-3162-5p	PAR-CLIP	23592263
MIRT489916	hsa-miR-7977	PAR-CLIP	23592263
MIRT489915	hsa-miR-2909	PAR-CLIP	23592263
MIRT496917	hsa-miR-193a-3p	PAR-CLIP	22291592
MIRT496916	hsa-miR-193b-3p	PAR-CLIP	22291592
MIRT496915	hsa-miR-4524b-3p	PAR-CLIP	22291592
MIRT496914	hsa-miR-4463	PAR-CLIP	22291592
MIRT496913	hsa-miR-4494	PAR-CLIP	22291592
MIRT496912	hsa-miR-3190-5p	PAR-CLIP	22291592
MIRT496911	hsa-miR-3926	PAR-CLIP	22291592
MIRT496910	hsa-miR-548s	PAR-CLIP	22291592
MIRT489925	hsa-miR-4323	PAR-CLIP	23592263
MIRT489924	hsa-miR-6760-5p	PAR-CLIP	23592263
MIRT489923	hsa-miR-1321	PAR-CLIP	23592263
MIRT489922	hsa-miR-4739	PAR-CLIP	23592263
MIRT489920	hsa-miR-4756-5p	PAR-CLIP	23592263
MIRT489921	hsa-miR-1225-3p	PAR-CLIP	23592263
MIRT489919	hsa-miR-6799-5p	PAR-CLIP	23592263
MIRT489918	hsa-miR-629-5p	PAR-CLIP	23592263
MIRT489917	hsa-miR-3162-5p	PAR-CLIP	23592263
MIRT489916	hsa-miR-7977	PAR-CLIP	23592263
MIRT489915	hsa-miR-2909	PAR-CLIP	23592263
MIRT1321893	hsa-miR-1236	CLIP-seq
MIRT1321894	hsa-miR-1285	CLIP-seq
MIRT1321895	hsa-miR-202	CLIP-seq
MIRT1321896	hsa-miR-299-3p	CLIP-seq
MIRT1321897	hsa-miR-3182	CLIP-seq
MIRT1321898	hsa-miR-3187-5p	CLIP-seq
MIRT1321899	hsa-miR-378g	CLIP-seq
MIRT1321900	hsa-miR-4307	CLIP-seq
MIRT1321901	hsa-miR-4314	CLIP-seq
MIRT1321902	hsa-miR-4457	CLIP-seq
MIRT1321903	hsa-miR-4486	CLIP-seq
MIRT1321904	hsa-miR-4648	CLIP-seq
MIRT1321905	hsa-miR-4654	CLIP-seq
MIRT1321906	hsa-miR-4753-3p	CLIP-seq
MIRT1321907	hsa-miR-4768-5p	CLIP-seq
MIRT1321908	hsa-miR-4769-5p	CLIP-seq
MIRT1321909	hsa-miR-513b	CLIP-seq
MIRT1321910	hsa-miR-563	CLIP-seq
MIRT1321911	hsa-miR-567	CLIP-seq
MIRT1321912	hsa-miR-612	CLIP-seq
MIRT1321913	hsa-miR-148a	CLIP-seq
MIRT1321914	hsa-miR-148b	CLIP-seq
MIRT1321915	hsa-miR-152	CLIP-seq
MIRT1321916	hsa-miR-3202	CLIP-seq
MIRT1321917	hsa-miR-320a	CLIP-seq
MIRT1321918	hsa-miR-320c	CLIP-seq
MIRT1321919	hsa-miR-320d	CLIP-seq
MIRT1321920	hsa-miR-320e	CLIP-seq
MIRT1321921	hsa-miR-330-3p	CLIP-seq
MIRT1321922	hsa-miR-4276	CLIP-seq
MIRT1321923	hsa-miR-4429	CLIP-seq
MIRT1321924	hsa-miR-4476	CLIP-seq
MIRT1321925	hsa-miR-4659a-3p	CLIP-seq
MIRT1321926	hsa-miR-4659b-3p	CLIP-seq
MIRT1321927	hsa-miR-629	CLIP-seq
MIRT1321928	hsa-miR-665	CLIP-seq
MIRT2095566	hsa-let-7a	CLIP-seq
MIRT2095567	hsa-let-7b	CLIP-seq
MIRT2095568	hsa-let-7c	CLIP-seq
MIRT2095569	hsa-let-7d	CLIP-seq
MIRT2095570	hsa-let-7e	CLIP-seq
MIRT2095571	hsa-let-7f	CLIP-seq
MIRT2095572	hsa-let-7g	CLIP-seq
MIRT2095573	hsa-let-7i	CLIP-seq
MIRT2095574	hsa-miR-130a	CLIP-seq
MIRT2095575	hsa-miR-130b	CLIP-seq
MIRT2095576	hsa-miR-145	CLIP-seq
MIRT1321913	hsa-miR-148a	CLIP-seq
MIRT1321914	hsa-miR-148b	CLIP-seq
MIRT1321915	hsa-miR-152	CLIP-seq
MIRT2095577	hsa-miR-1909	CLIP-seq
MIRT2095578	hsa-miR-301a	CLIP-seq
MIRT2095579	hsa-miR-301b	CLIP-seq
MIRT1321917	hsa-miR-320a	CLIP-seq
MIRT1321918	hsa-miR-320c	CLIP-seq
MIRT1321919	hsa-miR-320d	CLIP-seq
MIRT1321920	hsa-miR-320e	CLIP-seq
MIRT1321921	hsa-miR-330-3p	CLIP-seq
MIRT2095580	hsa-miR-3658	CLIP-seq
MIRT2095581	hsa-miR-3666	CLIP-seq
MIRT2095582	hsa-miR-4270	CLIP-seq
MIRT1321922	hsa-miR-4276	CLIP-seq
MIRT2095583	hsa-miR-4295	CLIP-seq
MIRT2095584	hsa-miR-4328	CLIP-seq
MIRT1321923	hsa-miR-4429	CLIP-seq
MIRT2095585	hsa-miR-4436b-3p	CLIP-seq
MIRT2095586	hsa-miR-4441	CLIP-seq
MIRT2095587	hsa-miR-4458	CLIP-seq
MIRT2095588	hsa-miR-4473	CLIP-seq
MIRT2095589	hsa-miR-4500	CLIP-seq
MIRT2095590	hsa-miR-454	CLIP-seq
MIRT1321925	hsa-miR-4659a-3p	CLIP-seq
MIRT1321926	hsa-miR-4659b-3p	CLIP-seq
MIRT2095591	hsa-miR-4671-3p	CLIP-seq
MIRT2095592	hsa-miR-4761-3p	CLIP-seq
MIRT2095593	hsa-miR-571	CLIP-seq
MIRT2095594	hsa-miR-659	CLIP-seq
MIRT2095595	hsa-miR-98	CLIP-seq

18 Show/Hide all (18)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0000281	Process	Mitotic cytokinesis	IBA
GO:0000915	Process	Actomyosin contractile ring assembly	IBA
GO:0005095	Function	GTPase inhibitor activity	IBA
GO:0005095	Function	GTPase inhibitor activity	IDA	10940294
GO:0005095	Function	GTPase inhibitor activity	IEA
GO:0005515	Function	Protein binding	IPI	10940294, 12879077, 16007136, 18256687, 18854161, 19294487, 19944695, 22621765, 22705156, 24525234, 25150978, 34591642
GO:0005525	Function	GTP binding	IEA
GO:0005826	Component	Actomyosin contractile ring	IBA
GO:0005829	Component	Cytosol	TAS
GO:0006915	Process	Apoptotic process	IEA
GO:0007165	Process	Signal transduction	IDA	10940294
GO:0007165	Process	Signal transduction	IEA
GO:0007266	Process	Rho protein signal transduction	IDA	15480428
GO:0031106	Process	Septin ring organization	IBA
GO:0031267	Function	Small GTPase binding	IDA	10940294
GO:0031267	Function	Small GTPase binding	IEA
GO:0042981	Process	Regulation of apoptotic process	IDA	15480428

MIM	HGNC	e!Ensembl
602288	10466	ENSG00000114993

Q9BST9

Protein name

Rhotekin

Protein function

Mediates Rho signaling to activate NF-kappa-B and may confer increased resistance to apoptosis to cells in gastric tumorigenesis. May play a novel role in the organization of septin structures. {ECO:0000269|PubMed:10940294, ECO:0000269|PubMed:15

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00169	PH	310 → 414	PH domain	Domain
PF08174	Anillin	117 → 270	Cell division protein anillin	Domain

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in prostate, moderately in kidney, heart, brain, spleen, testis, placenta, small intestine, pancreas, skeletal muscle and peripheral blood leukocytes, and weakly in ovary, colon and thymus. Weakly expressed in all norm

Sequence

MFSRNHRSRVTVARGSALEMEFKRGRFRLSLFSDLPEDTELQRKLDHEIRMREGACKLLA
ACSQREQALEATKSLLVCNSRILSYMGELQRRKEAQVLGKTSRRPSDSGPPAERSPCRGR
VCISDLRIPLMWKDTEYFKNKGDLHRWAVFLLLQLGEHIQDTEMILVDRTLTDISFQSNV
LFAEAGPDFELRLELYGACVEEEGALTGGPKRLATKLSSSLGRSSGRRVRASLDSAGGSG
SSPILLPTPVVGGPRYHLLAHTTLTLAAVQDGFRTHDLTLASHEENPAWLPLYGSVCCRL
AAQPLCMTQPTASGTLRVQQAGEMQNWAQVHGVLKGTNLFCYRQPEDADTGEEPLLTIAV
NKETRVRAGELDQALGRPFTLSISNQYGDDEVTHTLQTESREALQSWMEALWQLFFDMSQ
WKQCCDEIMKIETPAPRKPPQALAKQGSLYHEMAIEPLDDIAAVTDILTQREGARLETPP
PWLAMFTDQPALPNPCSPASVAPAPDWTHPLPWGRPRTFSLDAVPPDHSPRARSVAPLPP
QRSPRTRGLCSKGQPRTWLQSPV

Sequence length

563

Interactions

View interactions

Reactome Pathway
RHO GTPases Activate Rhotekin and Rhophilins

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Uterine corpus endometrial carcinoma	Uncertain significance	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (20)
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	26935528		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	19360360		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	15599595	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	15599595, 27922690		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	26935528		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	26349972, 27498032, 30551459		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	BEFREE	15316142		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	23563176		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	23563176		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	23963366	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	27922690		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	26935528	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	19360360		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	26935528		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	27922690, 30774435		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	15316142, 15599595, 27922690		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	26349972, 27498032, 30551459		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	15599595, 27498032, 30774435		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	27922690, 30774435		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	15599595	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Genes Genes most often co-reported with RTKN across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for RTKN.

Diseases Linked via Similar Genes Diseases curated for genes most similar to RTKN (see Related Genes above), that are NOT already directly curated for RTKN itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to RTKN.

RTKN (rhotekin)

Save This Analysis