RTCA (RNA 3'-terminal phosphate cyclase)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 8634
Gene name RNA 3'-terminal phosphate cyclase
Gene symbol RTCA
Synonyms (NCBI Gene)
RPCRTC1RTCD1
Chromosome 1
Chromosome location 1p21.2
Summary This gene encodes a member of the RNA 3`-phosphate cyclase family. The encoded protein plays a role in RNA metabolism by catalyzing the ATP-dependent conversion of the 3`-phosphate of RNA substrates to a 2`,3`-cyclic phosphodiester. Alternatively spliced
miRNA miRNA information provided by mirtarbase database.
6 Show/Hide all (6)
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT027548 hsa-miR-98-5p Microarray 19088304
MIRT032266 hsa-let-7b-5p Proteomics 18668040
MIRT032266 hsa-let-7b-5p CLASH 23622248
MIRT051005 hsa-miR-17-5p CLASH 23622248
MIRT048340 hsa-miR-106a-5p CLASH 23622248
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
18 Show/Hide all (18)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0000166 Function Nucleotide binding IEA
GO:0003723 Function RNA binding HDA 22658674
GO:0003723 Function RNA binding TAS 9184239
GO:0003824 Function Catalytic activity IEA
GO:0003963 Function RNA-3'-phosphate cyclase activity IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
611286 17981 ENSG00000137996
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O00442
Protein name RNA 3'-terminal phosphate cyclase (RNA cyclase) (RNA-3'-phosphate cyclase) (EC 6.5.1.4) (RNA terminal phosphate cyclase domain-containing protein 1) (RTC domain-containing protein 1)
Protein function Catalyzes the conversion of 3'-phosphate to a 2',3'-cyclic phosphodiester at the end of RNA (PubMed:9184239). The mechanism of action of the enzyme occurs in 3 steps: (A) adenylation of the enzyme by ATP; (B) transfer of adenylate to an RNA-N3'P
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01137 RTC 12 → 338 Domain
PF05189 RTC_insert 184 → 286 Domain
Tissue specificity TISSUE SPECIFICITY: Ubiquitous.
Sequence 
MAGPRVEVDGSIMEGGGQILRVSTALSCLLGLPLRVQKIRAGRSTPGLRPQHLSGLEMIR
DLCDGQLEGAEIGSTEITFTPEKIKGGIHTADTKTAGSVCLLMQVSMPCVLFAASPSELH
LKGGTNAEMAPQIDYTVMVFKPIVEKFGFIFNCDIKTRGYYPKGGGEVIVRMSPVKQLNP
INLTERGCVTKIYGRAFVAGVLPFKVAKDMAAAAVRCIRKEIRDLYVNIQPVQEPKDQAF
GNGNGIIIIAETSTGCLFAGSSLGKRGVNADKVGIEAAEMLLANLRHGGTVDEYLQDQLI
VFMALANGVSRIKTGPVTLHTQTAIHFAEQIAKAKFIVKKSEDEEDAAKDTYIIECQGIG
MTNPNL
Sequence length 366
Interactions View interactions

No strongly related genes found yet for RTCA.

No additional diseases found yet through genes similar to RTCA.