RRP7BP (ribosomal RNA processing 7 homolog B, pseudogene)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 91695
Gene name Ribosomal RNA processing 7 homolog B, pseudogene
Gene symbol RRP7BP
Synonyms (NCBI Gene)
RRP7BdJ222E13.2
Chromosome 22
Chromosome location 22q13.2
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
4
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0000028 Process Ribosomal small subunit assembly IBA
GO:0006364 Process RRNA processing IBA
GO:0032545 Component CURI complex IBA
GO:0034456 Component UTP-C complex IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9NSQ0
Protein name Putative ribosomal RNA-processing protein 7 homolog B (Putative gastric cancer antigen Zg14-like protein)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF12923 RRP7 1 → 103 Ribosomal RNA-processing protein 7 (RRP7) C-terminal domain Domain
Sequence 
MEAYDQKIAEEEAKAKEEEGVPDEEGWVKVTRRGRRPVLPRTEAASLRVLERERRKRSQK
ELLNYAWQHRESKMEHLAQLRKKFEEDKQRIELLRAQRKFRPY
Sequence length 103
Interactions View interactions

No strongly related genes found yet for RRP7BP.

No additional diseases found yet through genes similar to RRP7BP.