RRN3P1 (RRN3 pseudogene 1)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 730092
Gene name RRN3 pseudogene 1
Gene symbol RRN3P1
Synonyms (NCBI Gene)
-
Chromosome 16
Chromosome location 16p12.2
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
2
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0001181 Function RNA polymerase I general transcription initiation factor activity IEA
GO:0006361 Process Transcription initiation at RNA polymerase I promoter IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q2M238
Protein name Putative RRN3-like protein RRN3P1 (RNA polymerase I transcription factor homolog pseudogene 1)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF05327 RRN3 1 → 149 RNA polymerase I specific transcription initiation factor RRN3 Family
Sequence 
MGFAEAFLEHLWKNLQDPSNPAIIRQAAGNYIGSFLARAKFISLITVKPCLDLLVNWLHI
YLNNQDSGTKAFCDVALHGPFYSACQAVFYTFVFRHKQLLSGNLKEGLQYPQSLNFERIV
MSQLNPLKICLPSVVNFFAAITKMKTCGYGWW
Sequence length 152
Interactions View interactions

No strongly related genes found yet for RRN3P1.

No additional diseases found yet through genes similar to RRN3P1.