Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Other IDs Associated diseases
Entrez ID	6199
Gene name	Ribosomal protein S6 kinase B2
Gene symbol	RPS6KB2
Synonyms (NCBI Gene)	KLSP70-betaP70-beta-1P70-beta-2S6K-beta2S6K2S6KBS6KI(2)S6KbetaSRKSTK14Bp70(S6K)-betap70S6Kb
Chromosome	11
Chromosome location	11q13.2
Summary	This gene encodes a member of the RSK (ribosomal S6 kinase) family of serine/threonine kinases. This kinase contains a kinase catalytic domain and phosphorylates the S6 ribosomal protein and eukaryotic translation initiation factor 4B (eIF4B). Phosphoryla

Show/Hide all (71)

miRTarBase ID	miRNA	Experiments	Reference
MIRT027691	hsa-miR-98-5p	Microarray	19088304
MIRT029811	hsa-miR-26b-5p	Microarray	19088304
MIRT036102	hsa-miR-1296-5p	CLASH	23622248
MIRT1318846	hsa-miR-1470	CLIP-seq
MIRT1318847	hsa-miR-1908	CLIP-seq
MIRT1318848	hsa-miR-1973	CLIP-seq
MIRT1318849	hsa-miR-3127-5p	CLIP-seq
MIRT1318850	hsa-miR-3605-3p	CLIP-seq
MIRT1318851	hsa-miR-4290	CLIP-seq
MIRT1318852	hsa-miR-4641	CLIP-seq
MIRT1318853	hsa-miR-4688	CLIP-seq
MIRT1318854	hsa-miR-4767	CLIP-seq
MIRT1318855	hsa-miR-663	CLIP-seq
MIRT2094807	hsa-miR-1268	CLIP-seq
MIRT2094808	hsa-miR-1268b	CLIP-seq
MIRT2094809	hsa-miR-129-3p	CLIP-seq
MIRT1318846	hsa-miR-1470	CLIP-seq
MIRT1318847	hsa-miR-1908	CLIP-seq
MIRT1318848	hsa-miR-1973	CLIP-seq
MIRT2094810	hsa-miR-2277-5p	CLIP-seq
MIRT2094811	hsa-miR-3157-5p	CLIP-seq
MIRT2094812	hsa-miR-339-3p	CLIP-seq
MIRT1318850	hsa-miR-3605-3p	CLIP-seq
MIRT1318851	hsa-miR-4290	CLIP-seq
MIRT1318852	hsa-miR-4641	CLIP-seq
MIRT2094813	hsa-miR-4690-3p	CLIP-seq
MIRT1318854	hsa-miR-4767	CLIP-seq
MIRT1318855	hsa-miR-663	CLIP-seq
MIRT2094814	hsa-miR-744	CLIP-seq
MIRT2319213	hsa-miR-1228	CLIP-seq
MIRT2094807	hsa-miR-1268	CLIP-seq
MIRT2094808	hsa-miR-1268b	CLIP-seq
MIRT1318846	hsa-miR-1470	CLIP-seq
MIRT1318847	hsa-miR-1908	CLIP-seq
MIRT2319214	hsa-miR-1913	CLIP-seq
MIRT1318848	hsa-miR-1973	CLIP-seq
MIRT2319215	hsa-miR-22	CLIP-seq
MIRT2094810	hsa-miR-2277-5p	CLIP-seq
MIRT1318849	hsa-miR-3127-5p	CLIP-seq
MIRT2319216	hsa-miR-3166	CLIP-seq
MIRT2319217	hsa-miR-3189-5p	CLIP-seq
MIRT2319218	hsa-miR-324-3p	CLIP-seq
MIRT2319219	hsa-miR-329	CLIP-seq
MIRT2094812	hsa-miR-339-3p	CLIP-seq
MIRT1318850	hsa-miR-3605-3p	CLIP-seq
MIRT2319220	hsa-miR-361-3p	CLIP-seq
MIRT2319221	hsa-miR-362-3p	CLIP-seq
MIRT1318851	hsa-miR-4290	CLIP-seq
MIRT2319222	hsa-miR-4530	CLIP-seq
MIRT1318852	hsa-miR-4641	CLIP-seq
MIRT1318853	hsa-miR-4688	CLIP-seq
MIRT2319223	hsa-miR-4726-3p	CLIP-seq
MIRT2319224	hsa-miR-4758-3p	CLIP-seq
MIRT1318854	hsa-miR-4767	CLIP-seq
MIRT2319225	hsa-miR-603	CLIP-seq
MIRT1318855	hsa-miR-663	CLIP-seq
MIRT2094814	hsa-miR-744	CLIP-seq
MIRT2319226	hsa-miR-922	CLIP-seq
MIRT2319213	hsa-miR-1228	CLIP-seq
MIRT2614787	hsa-miR-1299	CLIP-seq
MIRT2614788	hsa-miR-1915	CLIP-seq
MIRT2614789	hsa-miR-193b	CLIP-seq
MIRT2614790	hsa-miR-3136-3p	CLIP-seq
MIRT2614791	hsa-miR-326	CLIP-seq
MIRT2319219	hsa-miR-329	CLIP-seq
MIRT2614792	hsa-miR-330-5p	CLIP-seq
MIRT2319220	hsa-miR-361-3p	CLIP-seq
MIRT2319221	hsa-miR-362-3p	CLIP-seq
MIRT2319223	hsa-miR-4726-3p	CLIP-seq
MIRT2614793	hsa-miR-593	CLIP-seq
MIRT2614794	hsa-miR-875-3p	CLIP-seq

Show/Hide all (29)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0002181	Process	Cytoplasmic translation	IDA	8706699, 34314702
GO:0004672	Function	Protein kinase activity	IEA
GO:0004672	Function	Protein kinase activity	TAS	9804755
GO:0004674	Function	Protein serine/threonine kinase activity	IBA
GO:0004674	Function	Protein serine/threonine kinase activity	IDA	29750193
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	TAS	9878560
GO:0004711	Function	Ribosomal protein S6 kinase activity	IEA
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IBA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0006412	Process	Translation	TAS	9804755
GO:0007165	Process	Signal transduction	IEA
GO:0007165	Process	Signal transduction	TAS	9804755
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0031929	Process	TOR signaling	IEA
GO:0031929	Process	TOR signaling	IMP	29750193
GO:0038202	Process	TORC1 signaling	IBA
GO:0042277	Function	Peptide binding	IEA
GO:0045948	Process	Positive regulation of translational initiation	IDA	29750193
GO:0045948	Process	Positive regulation of translational initiation	IEA
GO:0045948	Process	Positive regulation of translational initiation	IMP	16763566
GO:0046627	Process	Negative regulation of insulin receptor signaling pathway	IEA
GO:0106310	Function	Protein serine kinase activity	IEA

MIM	HGNC	e!Ensembl
608939	10437	ENSG00000175634

Q9UBS0

Protein name

Ribosomal protein S6 kinase beta-2 (S6K-beta-2) (S6K2) (EC 2.7.11.1) (70 kDa ribosomal protein S6 kinase 2) (P70S6K2) (p70-S6K 2) (S6 kinase-related kinase) (SRK) (Serine/threonine-protein kinase 14B) (p70 ribosomal S6 kinase beta) (S6K-beta) (p70 S6 kina

Protein function

Phosphorylates specifically ribosomal protein S6 (PubMed:29750193). Seems to act downstream of mTOR signaling in response to growth factors and nutrients to promote cell proliferation, cell growth and cell cycle progression in an alternative pat

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00069	Pkinase	67 → 328	Protein kinase domain	Domain
PF00433	Pkinase_C	349 → 389	Protein kinase C terminal domain	Family

Sequence

MAAVFDLDLETEEGSEGEGEPELSPADACPLAELRAAGLEPVGHYEEVELTETSVNVGPE
RIGPHCFELLRVLGKGGYGKVFQVRKVQGTNLGKIYAMKVLRKAKIVRNAKDTAHTRAER
NILESVKHPFIVELAYAFQTGGKLYLILECLSGGELFTHLEREGIFLEDTACFYLAEITL
ALGHLHSQGIIYRDLKPENIMLSSQGHIKLTDFGLCKESIHEGAVTHTFCGTIEYMAPEI
LVRSGHNRAVDWWSLGALMYDMLTGSPPFTAENRKKTMDKIIRGKLALPPYLTPDARDLV
KKFLKRNPSQRIGGGPGDAADVQRHPFFRHMNWDDLLAWRVDPPFRPCLQSEEDVSQFDT
RFTRQTPVDSPDDTALSESANQAFLGFTYVAPSVLDSIKEGFSFQPKLRSPRRLNSSPRA
PVSPLKFSPFEGFRPSPSLPEPTELPLPPLLPPPPPSTTAPLPIRPPSGTKKSKRGRGRP
GR

Sequence length

482

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BREAST NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RPS6KB2-related disorder	Uncertain significance; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (38)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute Erythroblastic Leukemia	Erythroblastic Leukemia	BEFREE	9878560		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	BEFREE	21444676		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	21811019	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	29058037		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	20953835, 21748818, 24131622, 26698305, 30128822		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	20953835		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	24131622, 25972244, 26577839, 26698305	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cataract	Cataract	BEFREE	31486917		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	29344170		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	21035469	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common variable immunodeficiency	Pubtator	26081581	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital keratoglobus	Congenital Keratoglobus	BEFREE	31146719		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endocrine System Diseases	Endocrine system disease	Pubtator	24131622	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophagitis	Esophagitis	BEFREE	26991123		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophagitis	Esotropia	Pubtator	26991123	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	Pubtator	31570771	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	34705606	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	24131622	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	28944926		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	28944926	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	20953835, 21748818, 24131622, 26698305, 30128822		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	20953835		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	23393338		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	23393338, 30730779		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	20953835		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	20953835		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	20953835		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	20953835		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	20953835, 25972244, 26577839, 26698305		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	19575820, 24469061		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Mucinous Adenocarcinoma	Ovarian adenocarcinoma	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	BEFREE	21444676		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schinzel-Giedion syndrome	Schinzel-Giedion Syndrome	BEFREE	30368394		★★★★★ ★☆☆☆☆ Found in Text Mining only
Shprintzen-Goldberg syndrome	Shprintzen-Goldberg Syndrome	BEFREE	30368394		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	16810323	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Spinal Muscular Atrophy	Spinal Muscular Atrophy	BEFREE	30481286		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	23393338		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	23874846	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

RPS6KB2 (ribosomal protein S6 kinase B2)