RPS10P5 (ribosomal protein S10 pseudogene 5)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 93144
Gene name Ribosomal protein S10 pseudogene 5
Gene symbol RPS10P5
Synonyms (NCBI Gene)
RPS10LRPS10_13_1677bA371L19.2
Chromosome 20
Chromosome location 20p13
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
7 Show/Hide all (7)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0003723 Function RNA binding IBA
GO:0003735 Function Structural constituent of ribosome IBA
GO:0003735 Function Structural constituent of ribosome IEA
GO:0005840 Component Ribosome IEA
GO:0022626 Component Cytosolic ribosome IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9NQ39
Protein name Putative ribosomal protein eS10-like (Putative 40S ribosomal protein S10-like)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF03501 S10_plectin 3 → 95 Plectin/S10 domain Domain
Sequence 
MLMPKKNRIAIHELLFKEGVMVAKKDVHMPKHPELADKNVPNLHVMKAMQSLKSRGCVKE
QFAWRHFYWYLTNEGSQYLRDYLHLPPEIVPATLHLPPEIVPATLHRSRPETGRPRPKGL
EGKRPARLTRREADRDTYRRCSVPPGADKKAEAGAGSATEFQFRGRCGRGRGQPPQ
Sequence length 176
Interactions View interactions

No strongly related genes found yet for RPS10P5.

No additional diseases found yet through genes similar to RPS10P5.