RPRML (reprimo like)

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 388394
Gene name Reprimo like
Gene symbol RPRML
Synonyms (NCBI Gene)
-
Chromosome 17
Chromosome location 17q21.32
miRNA miRNA information provided by mirtarbase database.
7 Show/Hide all (7)
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT1317616 hsa-miR-103a CLIP-seq
MIRT1317617 hsa-miR-107 CLIP-seq
MIRT1317618 hsa-miR-1237 CLIP-seq
MIRT1317619 hsa-miR-1248 CLIP-seq
MIRT1317620 hsa-miR-1301 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
1
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0016020 Component Membrane IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8N4K4
Protein name Reprimo-like protein
Family and domains
Sequence 
MNATFLNHSGLEEVDGVGGGAGAALGNRTHGLGTWLGCCPGGAPLAASDGVPAGLAPDER
SLWVSRVAQIAVLCVLSLTVVFGVFFLGCNLLIKSESMINFLVQERRPSKDVGAAILGLY
Sequence length 120
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Download as csvDownload as pdf
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Reference Evidence Score
CONGENITAL HEART DISEASE — GWAS catalog 38454350
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Stomach Neoplasms Stomach neoplasms Pubtator 33322837 Inhibit
★★★★★
★☆☆☆☆
Found in Text Mining only

No strongly related genes found yet for RPRML.

No additional diseases found yet through genes similar to RPRML.