RPP25L (ribonuclease P/MRP subunit p25 like)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 138716
Gene name Ribonuclease P/MRP subunit p25 like
Gene symbol RPP25L
Synonyms (NCBI Gene)
C9orf23bA296L22.5
Chromosome 9
Chromosome location 9p13.3
Summary This gene encodes a protein that appears to belong to a family of evolutionarily related proteins (DUF78), that may share one or more domains in common. Members of this family are small archaebacterial proteins with no known function. Alternative splicing
miRNA miRNA information provided by mirtarbase database.
23 Show/Hide all (23)
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT022708 hsa-miR-124-3p Microarray 18668037
MIRT028698 hsa-miR-27a-3p Sequencing 20371350
MIRT042603 hsa-miR-423-3p CLASH 23622248
MIRT497349 hsa-miR-888-5p PAR-CLIP 22291592
MIRT497348 hsa-miR-6715a-3p PAR-CLIP 22291592
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
7 Show/Hide all (7)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0000172 Component Ribonuclease MRP complex IBA
GO:0001682 Process TRNA 5'-leader removal IBA
GO:0003676 Function Nucleic acid binding IEA
GO:0003723 Function RNA binding HDA 22681889
GO:0003723 Function RNA binding IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8N5L8
Protein name Ribonuclease P protein subunit p25-like protein (RNase P protein subunit-like p25) (Rpp25-like protein)
Protein function May be a component of ribonuclease P or MRP.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01918 Alba 26 → 91 Alba Family
Sequence 
MEHYRKAGSVELPAPSPMPQLPPDTLEMRVRDGSKIRNLLGLALGRLEGGSARHVVFSGS
GRAAGKAVSCAEIVKRRVPGLHQLTKLRFLQTEDSWVPASPDTGLDPLTVRRHVPAVWVL
LSRDPLDPNECGYQPPGAPPGLGSMPSSSCGPRSRRRARDTRS
Sequence length 163
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
KEGG Pathway
Ribosome biogenesis in eukaryotes

No strongly related genes found yet for RPP25L.

No additional diseases found yet through genes similar to RPP25L.