RPLP0P6 (ribosomal protein lateral stalk subunit P0 pseudogene 6)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 220717
Gene name Ribosomal protein lateral stalk subunit P0 pseudogene 6
Gene symbol RPLP0P6
Synonyms (NCBI Gene)
RPLP0_2_209
Chromosome 2
Chromosome location 2p22.1
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
7 Show/Hide all (7)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0002181 Process Cytoplasmic translation IBA
GO:0003735 Function Structural constituent of ribosome IBA
GO:0005840 Component Ribosome IEA
GO:0022625 Component Cytosolic large ribosomal subunit IBA
GO:0042254 Process Ribosome biogenesis IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8NHW5
Protein name Putative ribosomal protein uL10-like (60S acidic ribosomal protein P0-like) (Large ribosomal subunit protein uL10-like)
Protein function Ribosomal protein P0 is the functional equivalent of E.coli protein L10.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00428 Ribosomal_60s 231 → 316 Family
PF00466 Ribosomal_L10 5 → 106 Ribosomal protein L10 Family
PF17777 RL10P_insert 111 → 180 Insertion domain in 60S ribosomal protein L10P Domain
Sequence 
MPREDRATWKSNYFLKIIQLLDDYPKCFIVGADNVGSKQMQQIRMSLRGKVVVLMGKNTM
MRKAIRGHLENNPALEKLLPHIWGNVGFVFTKEDLTEIRDMLLANKVPAAARAGAIAPCE
VTVPAQNTGLGPEKTSFFQALGITTKISRGTIEILSDVQLIKTGDKVGASEATLLNMLNI
SPFSFGLVIQQVFDNGSIYNPEVLDKTEETLHSRFLEGVRNVASVCLQTGYPTVASVPHS
IINGYKRVLALSVETDYTFPLAENVKAFLADPSAFVAAAPVAADTTAAPAAAAAPAKVEA
KEESEESDEDMGFGLFD
Sequence length 317
Interactions View interactions

No strongly related genes found yet for RPLP0P6.

No additional diseases found yet through genes similar to RPLP0P6.