RPL37AP8 (ribosomal protein L37a pseudogene 8)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 644338
Gene name Ribosomal protein L37a pseudogene 8
Gene symbol RPL37AP8
Synonyms (NCBI Gene)
RPL37A_3_1174
Chromosome 11
Chromosome location 11q23.1
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
8 Show/Hide all (8)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0003735 Function Structural constituent of ribosome IEA
GO:0005840 Component Ribosome IEA
GO:0006412 Process Translation IEA
GO:0008270 Function Zinc ion binding IEA
GO:0022625 Component Cytosolic large ribosomal subunit IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC 35645 N/A
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
A6NKH3
Protein name Putative ribosomal protein eL43-like (Putative 60S ribosomal protein L37a-like protein) (Ribosomal protein L37a pseudogene 8)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01780 Ribosomal_L37ae 4 → 89 Ribosomal L37ae protein family Family
Sequence 
MAKCTKKVGGIVSKYRTHHGASLWKMVKEIEISQHTKYTCSFCGKTKMKRRAVKIRHCNS
CMKTVAGSAWTYNTTSAVMVKSAIRRLKELKDQ
Sequence length 93
Interactions View interactions

No strongly related genes found yet for RPL37AP8.

No additional diseases found yet through genes similar to RPL37AP8.