RPL13AP3 (ribosomal protein L13a pseudogene 3)

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 645683
Gene name Ribosomal protein L13a pseudogene 3
Gene symbol RPL13AP3
Synonyms (NCBI Gene)
RPL13A_11_1370
Chromosome 14
Chromosome location 14q22.3
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
5
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0003735 Function Structural constituent of ribosome IEA
GO:0005634 Component Nucleus HDA 21630459
GO:0005840 Component Ribosome IEA
GO:0006412 Process Translation IEA
GO:1990904 Component Ribonucleoprotein complex IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q6NVV1
Protein name Putative ribosomal protein uL13-like (60S ribosomal protein L13a pseudogene 3) (Putative 60S ribosomal protein L13a protein RPL13AP3)
Family and domains
Sequence 
MLRHKTKRGHASLDCLKVFDGIPPPYDKKKRMVVPAALKVVRLKPTRKFALLGRQAQEVR
WKYQAVTATLEEKRKEKAKIHYWKKKQLMRLRKQAEKNVKKN
Sequence length 102
Interactions View interactions

No strongly related genes found yet for RPL13AP3.

No additional diseases found yet through genes similar to RPL13AP3.