ROPN1B (rhophilin associated tail protein 1B)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 152015
Gene name Rhophilin associated tail protein 1B
Gene symbol ROPN1B
Synonyms (NCBI Gene)
-
Chromosome 3
Chromosome location 3q21.2
miRNA miRNA information provided by mirtarbase database.
1
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT1315124 hsa-miR-4705 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
22 Show/Hide all (22)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 11278869
GO:0005737 Component Cytoplasm IBA
GO:0005737 Component Cytoplasm IDA 11278869
GO:0005929 Component Cilium IEA
GO:0007266 Process Rho protein signal transduction TAS 11278869
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9BZX4
Protein name Ropporin-1B (Rhophilin-associated protein 1B)
Protein function Important for male fertility. With ROPN1L, involved in fibrous sheath integrity and sperm motility, plays a role in PKA-dependent signaling processes required for spermatozoa capacitation.
Family and domains
Sequence 
MAQTDKPTCIPPELPKMLKEFAKAAIRAQPQDLIQWGADYFEALSRGETPPVRERSERVA
LCNWAELTPELLKILHSQVAGRLIIRAEELAQMWKVVNLPTDLFNSVMNVGRFTEEIEWL
KFLALACSALGVTITKTLKIVCEVLSCDHNGGLPRIPFSTFQFLYTYIAEVDGEICASHV
SRMLNYIEQEVIGPDGLITVNDFTQNPRVWLE
Sequence length 212
Interactions View interactions

No strongly related genes found yet for ROPN1B.

No additional diseases found yet through genes similar to ROPN1B.