ROPN1 (rhophilin associated tail protein 1)

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 54763
Gene name Rhophilin associated tail protein 1
Gene symbol ROPN1
Synonyms (NCBI Gene)
CT91ODF6RHPNAP1ROPN1Aropporin
Chromosome 3
Chromosome location 3q21.1
Summary The protein encoded by this gene is found in the fibrous sheath of spermatazoa, where it interacts with rhophilin, a Rho GTPase binding protein. The encoded protein also can bind an A-kinase anchoring protein (AKAP110) and a calcium-binding tyrosine phosp
miRNA miRNA information provided by mirtarbase database.
1
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT2318155 hsa-miR-4742-3p CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
14 Show/Hide all (14)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 17551920, 25416956, 27107012, 29892012, 31515488, 32296183
GO:0005634 Component Nucleus HDA 21630459
GO:0005737 Component Cytoplasm IBA
GO:0005737 Component Cytoplasm IDA 18421703
GO:0005929 Component Cilium IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
611757 17692 ENSG00000065371
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9HAT0
Protein name Ropporin-1A (Cancer/testis antigen 91) (CT91) (Rhophilin-associated protein 1A)
Protein function Important for male fertility. With ROPN1L, involved in fibrous sheath integrity and sperm motility, plays a role in PKA-dependent signaling processes required for spermatozoa capacitation.
Family and domains
Tissue specificity TISSUE SPECIFICITY: Testis specific in adult. Overexpressed in hematologic tumor cells. {ECO:0000269|PubMed:17551920}.
Sequence 
MAQTDKPTCIPPELPKMLKEFAKAAIRVQPQDLIQWAADYFEALSRGETPPVRERSERVA
LCNRAELTPELLKILHSQVAGRLIIRAEELAQMWKVVNLPTDLFNSVMNVGRFTEEIEWL
KFLALACSALGVTITKTLKIVCEVLSCDHNGGSPRIPFSTFQFLYTYIAKVDGEISASHV
SRMLNYMEQEVIGPDGIITVNDFTQNPRVQLE
Sequence length 212
Interactions View interactions

No strongly related genes found yet for ROPN1.

No additional diseases found yet through genes similar to ROPN1.