RO60 (Ro60, Y RNA binding protein)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene Gene ontology Other IDs Protein Pathways Related genes Diseases linked via similar genes

Gene

• Entrez ID: 6738
• Gene name: Ro60, Y RNA binding protein
• Gene symbol: RO60
• Synonyms (NCBI Gene): RORNP, SSA2, TROVE2
• Chromosome: 1
• Chromosome location: 1q31.2

Gene ontology (GO) Show/Hide all (24)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002520	Process	Immune system development	IEA
GO:0003723	Function	RNA binding	IBA
GO:0003723	Function	RNA binding	IDA	26382853
GO:0003723	Function	RNA binding	IEA
GO:0003723	Function	RNA binding	TAS	3200833
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005929	Component	Cilium	IDA
GO:0006383	Process	Transcription by RNA polymerase III	TAS	3200833
GO:0007224	Process	Smoothened signaling pathway	IEA
GO:0009411	Process	Response to UV	IEA
GO:0010468	Process	Regulation of gene expression	IDA	26382853
GO:0016604	Component	Nuclear body	IDA
GO:0030030	Process	Cell projection organization	IEA
GO:0030620	Function	U2 snRNA binding	IEA
GO:0035457	Process	Cellular response to interferon-alpha	IDA	26382853
GO:0046872	Function	Metal ion binding	IEA
GO:0060271	Process	Cilium assembly	IEA
GO:1990904	Component	Ribonucleoprotein complex	IBA
GO:1990904	Component	Ribonucleoprotein complex	IDA	17289661
GO:1990904	Component	Ribonucleoprotein complex	IEA
GO:1990904	Component	Ribonucleoprotein complex	TAS	3200833

Other IDs

• MIM: 600063
• HGNC: 11313
• e!Ensembl: ENSG00000116747

Protein

• UniProt ID: P10155
• Protein name: RNA-binding protein RO60 (60 kDa SS-A/Ro ribonucleoprotein) (60 kDa Ro protein) (60 kDa ribonucleoprotein Ro) (RoRNP) (Ro 60 kDa autoantigen) (Ro60 autoantigen) (Sjoegren syndrome antigen A2) (Sjoegren syndrome type A antigen) (SS-A) (TROVE domain family
• Protein function: RNA-binding protein that binds to misfolded non-coding RNAs, pre-5S rRNA, and several small cytoplasmic RNA molecules known as Y RNAs (PubMed:18056422, PubMed:26382853). Binds to endogenous Alu retroelements which are induced by type I interfero
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF05731	TROVE	16 → 332	TROVE domain	Domain

• Sequence:

  MEESVNQMQPLNEKQIANSQDGYVWQVTDMNRLHRFLCFGSEGGTYYIKEQKLGLENAEA
  LIRLIEDGRGCEVIQEIKSFSQEGRTTKQEPMLFALAICSQCSDISTKQAAFKAVSEVCR
  IPTHLFTFIQFKKDLKESMKCGMWGRALRKAIADWYNEKGGMALALAVTKYKQRNGWSHK
  DLLRLSHLKPSSEGLAIVTKYITKGWKEVHELYKEKALSVETEKLLKYLEAVEKVKRTRD
  ELEVIHLIEEHRLVREHLLTNHLKSKEVWKALLQEMPLTALLRNLGKMTANSVLEPGNSE
  VSLVCEKLCNEKLLKKARIHPFHILIALETYKTGHGLRGKLKWRPDEEILKALDAAFYKT
  FKTVEPTGKRFLLAVDVSASMNQRVLGSILNASTVAAAMCMVVTRTEKDSYVVAFSDEMV
  PCPVTTDMTLQQVLMAMSQIPAGGTDCSLPMIWAQKTNTPADVFIVFTDNETFAGGVHPA
  IALREYRKKMDIPAKLIVCGMTSNGFTIADPDDRGMLDMCGFDTGALDVIRNFTLDMI

• Sequence length: 538

Pathways

KEGG Pathway:

Systemic lupus erythematosus

Related Genes

No strongly related genes found yet for RO60.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to RO60.