Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	64320
Gene name	Ring finger protein 25
Gene symbol	RNF25
Synonyms (NCBI Gene)	AO7
Chromosome	2
Chromosome location	2q35
Summary	The protein encoded by this gene contains a RING finger motif. The mouse counterpart of this protein has been shown to interact with Rela, the p65 subunit of NF-kappaB (NFKB), and modulate NFKB-mediated transcription activity. The mouse protein also binds

miRTarBase ID	miRNA	Experiments	Reference
MIRT039726	hsa-miR-615-3p	CLASH	23622248

29 Show/Hide all (29)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004842	Function	Ubiquitin-protein transferase activity	IEA
GO:0004842	Function	Ubiquitin-protein transferase activity	ISS
GO:0005515	Function	Protein binding	IPI	18757723, 19549727, 19690564, 28514442, 32296183, 32814053, 33961781
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	12748188
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA	12748188
GO:0006414	Process	Translational elongation	IDA	36638793
GO:0006415	Process	Translational termination	IDA	27863242
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	IBA
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	IDA	36638793
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	IDA	27863242
GO:0008270	Function	Zinc ion binding	IEA
GO:0016567	Process	Protein ubiquitination	IEA
GO:0016567	Process	Protein ubiquitination	ISS
GO:0016740	Function	Transferase activity	IEA
GO:0022626	Component	Cytosolic ribosome	IDA	27863242, 36638793
GO:0046872	Function	Metal ion binding	IEA
GO:0051059	Function	NF-kappaB binding	IPI	12748188
GO:0051092	Process	Positive regulation of NF-kappaB transcription factor activity	IDA	12748188
GO:0061630	Function	Ubiquitin protein ligase activity	IBA
GO:0061630	Function	Ubiquitin protein ligase activity	IDA	26475854, 27863242, 36638793, 37651229, 37951215
GO:0061630	Function	Ubiquitin protein ligase activity	IEA
GO:0072344	Process	Rescue of stalled ribosome	IBA
GO:0072344	Process	Rescue of stalled ribosome	IDA	27863242, 36638793, 37651229, 37951216
GO:0085020	Process	Protein K6-linked ubiquitination	IDA	37951215, 37951216
GO:0085020	Process	Protein K6-linked ubiquitination	IDA	27863242
GO:0160127	Process	Protein-RNA covalent cross-linking repair	IDA	37951215, 37951216
GO:0160127	Process	Protein-RNA covalent cross-linking repair	IDA	37951215

MIM	HGNC	e!Ensembl
616014	14662	ENSG00000163481

Q96BH1

Protein name

E3 ubiquitin-protein ligase RNF25 (EC 2.3.2.27) (RING finger protein 25) (RING finger protein AO7)

Protein function

E3 ubiquitin-protein ligase that plays a key role in the RNF14-RNF25 translation quality control pathway, a pathway that takes place when a ribosome has stalled during translation, and which promotes ubiquitination and degradation of translation

PDB

2DAY , 2DMF , 5D1K , 5D1L , 5D1M

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF05773	RWD	16 → 125	RWD domain	Domain
PF17123	zf-RING_11	134 → 162	RING-like zinc finger	Domain

Sequence

MAASASAAAGEEDWVLPSEVEVLESIYLDELQVIKGNGRTSPWEIYITLHPATAEDQDSQ
YVCFTLVLQVPAEYPHEVPQISIRNPRGLSDEQIHTILQVLGHVAKAGLGTAMLYELIEK
GKEILTDNNIPHGQCVICLYGFQEKEAFTKTPCYHYFHCHCLARYIQHMEQELKAQGQEQ
EQERQHATTKQKAVGVQCPVCREPLVYDLASLKAAPEPQQPMELYQPSAESLRQQEERKR
LYQRQQERGGIIDLEAERNRYFISLQQPPAPAEPESAVDVSKGSQPPSTLAAELSTSPAV
QSTLPPPLPVATQHICEKIPGTRSNQQRLGETQKAMLDPPKPSRGPWRQPERRHPKGGEC
HAPKGTRDTQELPPPEGPLKEPMDLKPEPHSQGVEGPPQEKGPGSWQGPPPRRTRDCVRW
ERSKGRTPGSSYPRLPRGQGAYRPGTRRESLGLESKDGS

Sequence length

459

Interactions

View interactions

Reactome Pathway
Antigen processing: Ubiquitination & Proteasome degradation

Related Genes Genes most often co-reported with RNF25 across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for RNF25.

Diseases Linked via Similar Genes Diseases curated for genes most similar to RNF25 (see Related Genes above), that are NOT already directly curated for RNF25 itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to RNF25.

RNF25 (ring finger protein 25)

Bookmark This Gene