RNF224 (ring finger protein 224)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 643596
Gene name Ring finger protein 224
Gene symbol RNF224
Synonyms (NCBI Gene)
-
Chromosome 9
Chromosome location 9q34.3
miRNA miRNA information provided by mirtarbase database.
7 Show/Hide all (7)
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT1312407 hsa-miR-425 CLIP-seq
MIRT1312408 hsa-miR-4505 CLIP-seq
MIRT2092857 hsa-miR-1205 CLIP-seq
MIRT2092858 hsa-miR-1909 CLIP-seq
MIRT2092859 hsa-miR-331-3p CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
2
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0008270 Function Zinc ion binding IEA
GO:0046872 Function Metal ion binding IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P0DH78
Protein name RING finger protein 224
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13445 zf-RING_UBOX 24 → 68 RING-type zinc-finger Domain
Sequence 
MQDAAAGGPPGLGGGGPPEERTDCIICCSAYDLSGHLPRRLYCGHTFCQACVRRLDTPAP
EQRWIPCPQCRQSTPTPRGGVAMLDLDLAAFLAVKAEREPARLEPLPLTSLKGSAITRQP
AGLCPALGPQPHFPQPRYCCWGCGSLCCPPLGSPEV
Sequence length 156
Interactions View interactions

No strongly related genes found yet for RNF224.

No additional diseases found yet through genes similar to RNF224.