RNF183 (ring finger protein 183)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Related genes Diseases linked via similar genes

Gene

• Entrez ID: 138065
• Gene name: Ring finger protein 183
• Gene symbol: RNF183
• Synonyms (NCBI Gene): -
• Chromosome: 9
• Chromosome location: 9q32

miRNA Show/Hide all (23)

miRTarBase ID	miRNA	Experiments	Reference
MIRT019218	hsa-miR-335-5p	Microarray	18185580
MIRT1311514	hsa-miR-1231	CLIP-seq
MIRT1311515	hsa-miR-127-5p	CLIP-seq
MIRT1311516	hsa-miR-129-5p	CLIP-seq
MIRT1311517	hsa-miR-3655	CLIP-seq
MIRT1311518	hsa-miR-4282	CLIP-seq
MIRT1311519	hsa-miR-4288	CLIP-seq
MIRT1311520	hsa-miR-4292	CLIP-seq
MIRT1311521	hsa-miR-4308	CLIP-seq
MIRT1311522	hsa-miR-4464	CLIP-seq
MIRT1311523	hsa-miR-4748	CLIP-seq
MIRT1311524	hsa-miR-508-3p	CLIP-seq
MIRT1311525	hsa-miR-578	CLIP-seq
MIRT1311526	hsa-miR-632	CLIP-seq
MIRT1311527	hsa-miR-659	CLIP-seq
MIRT1311516	hsa-miR-129-5p	CLIP-seq
MIRT2612966	hsa-miR-1910	CLIP-seq
MIRT2612967	hsa-miR-205	CLIP-seq
MIRT2612968	hsa-miR-498	CLIP-seq
MIRT1311516	hsa-miR-129-5p	CLIP-seq
MIRT2612966	hsa-miR-1910	CLIP-seq
MIRT2612967	hsa-miR-205	CLIP-seq
MIRT2612968	hsa-miR-498	CLIP-seq

Gene ontology (GO) Show/Hide all (31)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000209	Process	Protein polyubiquitination	IDA	26567849
GO:0000209	Process	Protein polyubiquitination	IMP	29507230
GO:0005515	Function	Protein binding	IPI	16189514, 25416956, 32296183, 32814053
GO:0005764	Component	Lysosome	IEA
GO:0005765	Component	Lysosomal membrane	IEA
GO:0005765	Component	Lysosomal membrane	ISS
GO:0005783	Component	Endoplasmic reticulum	IDA	26567849
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IBA
GO:0005789	Component	Endoplasmic reticulum membrane	IDA	29507230
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005794	Component	Golgi apparatus	IEA
GO:0006915	Process	Apoptotic process	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0016020	Component	Membrane	IEA
GO:0016567	Process	Protein ubiquitination	IBA
GO:0016567	Process	Protein ubiquitination	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0033106	Component	Cis-Golgi network membrane	IEA
GO:0033106	Component	Cis-Golgi network membrane	ISS
GO:0034976	Process	Response to endoplasmic reticulum stress	IBA
GO:0034976	Process	Response to endoplasmic reticulum stress	IDA	29507230
GO:0046872	Function	Metal ion binding	IEA
GO:0051865	Process	Protein autoubiquitination	IEA
GO:0051865	Process	Protein autoubiquitination	IMP	29507230
GO:0061630	Function	Ubiquitin protein ligase activity	IBA
GO:0061630	Function	Ubiquitin protein ligase activity	IDA	26567849
GO:0061630	Function	Ubiquitin protein ligase activity	IEA
GO:0061630	Function	Ubiquitin protein ligase activity	IMP	29507230
GO:1902237	Process	Positive regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway	IBA
GO:1902237	Process	Positive regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway	IMP	29507230

Other IDs

• MIM: 621029
• HGNC: 28721
• e!Ensembl: ENSG00000165188

Protein

• UniProt ID: Q96D59
• Protein name: E3 ubiquitin-protein ligase RNF183 (EC 2.3.2.27)
• Protein function: Acts as an E3 ubiquitin ligase catalyzing the covalent attachment of ubiquitin moieties onto substrate proteins (PubMed:29507230). Triggers apoptosis in response to prolonged ER stress by mediating the polyubiquitination and subsequent proteasom
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF13639	zf-RING_2	11 → 60	Ring finger domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Kidney and testis. {ECO:0000269|PubMed:29300766}.
• Sequence:

  MAEQQGRELEAECPVCWNPFNNTFHTPKMLDCCHSFCVECLAHLSLVTPARRRLLCPLCR
  QPTVLASGQPVTDLPTDTAMLALLRLEPHHVILEGHQLCLKDQPKSRYFLRQPQVYTLDL
  GPQPGGQTGPPPDTASATVSTPILIPSHHSLRECFRNPQFRIFAYLMAVILSVTLLLIFS
  IFWTKQFLWGVG

• Sequence length: 192

Related Genes

No strongly related genes found yet for RNF183.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to RNF183.