RNF181 (ring finger protein 181)

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 51255
Gene name Ring finger protein 181
Gene symbol RNF181
Synonyms (NCBI Gene)
HSPC238
Chromosome 2
Chromosome location 2p11.2
Summary RNF181 binds the integrin alpha-IIb (ITGA2B; MIM 607759)/beta-3 (ITGB3; MIM 173470) complex and has E3 ubiquitin ligase activity (Brophy et al., 2008 [PubMed 18331836]).[supplied by OMIM, Dec 2008]
miRNA miRNA information provided by mirtarbase database.
2
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT040738 hsa-miR-92b-3p CLASH 23622248
MIRT036911 hsa-miR-877-3p CLASH 23622248
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
16 Show/Hide all (16)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0004842 Function Ubiquitin-protein transferase activity IDA 24105792
GO:0004842 Function Ubiquitin-protein transferase activity IEA
GO:0005515 Function Protein binding IPI 19690564, 32296183
GO:0005737 Component Cytoplasm IBA
GO:0005737 Component Cytoplasm TAS
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
612490 28037 ENSG00000168894
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9P0P0
Protein name E3 ubiquitin-protein ligase RNF181 (EC 2.3.2.27) (RING finger protein 181)
Protein function E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates (PubMed:18331836). Catalyzes monoubiquitination of 26S protea
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13639 zf-RING_2 74 → 117 Ring finger domain Domain
Tissue specificity TISSUE SPECIFICITY: Widely expressed, with highest levels in liver and heart and lowest levels in brain and skeletal muscle. Expressed in platelets (at protein level). {ECO:0000269|PubMed:18331836}.
Sequence 
MASYFDEHDCEPSDPEQETRTNMLLELARSLFNRMDFEDLGLVVDWDHHLPPPAAKTVVE
NLPRTVIRGSQAELKCPVCLLEFEEEETAIEMPCHHLFHSSCILPWLSKTNSCPLCRYEL
PTDDDTYEEHRRDKARKQQQQHRLENLHGAMYT
Sequence length 153
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
Reactome Pathway
E3 ubiquitin ligases ubiquitinate target proteins

No strongly related genes found yet for RNF181.

No additional diseases found yet through genes similar to RNF181.