RNF148 (ring finger protein 148)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 378925
Gene name Ring finger protein 148
Gene symbol RNF148
Synonyms (NCBI Gene)
-
Chromosome 7
Chromosome location 7q31.32
miRNA miRNA information provided by mirtarbase database.
8 Show/Hide all (8)
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT1310649 hsa-miR-1285 CLIP-seq
MIRT1310650 hsa-miR-3161 CLIP-seq
MIRT1310651 hsa-miR-3173-3p CLIP-seq
MIRT1310652 hsa-miR-3187-5p CLIP-seq
MIRT1310653 hsa-miR-3945 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
9 Show/Hide all (9)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005737 Component Cytoplasm IBA
GO:0005770 Component Late endosome IBA
GO:0005783 Component Endoplasmic reticulum IBA
GO:0005794 Component Golgi apparatus IBA
GO:0006511 Process Ubiquitin-dependent protein catabolic process IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8N7C7
Protein name RING finger protein 148
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02225 PA 71 → 163 PA domain Family
PF13639 zf-RING_2 256 → 299 Ring finger domain Domain
Tissue specificity TISSUE SPECIFICITY: Abundantly expressed in testis and slightly in pancreas. Mainly present in the interstitial cells of testicular tissues. {ECO:0000269|PubMed:24089095, ECO:0000269|PubMed:35831855}.
Sequence 
MSFLRITPSTHSSVSSGLLRLSIFLLLSFPDSNGKAIWTAHLNITFQVGNEITSELGESG
VFGNHSPLERVSGVVALPEGWNQNACHPLTNFSRPKQADSWLALIERGGCTFTHKINVAA
EKGANGVIIYNYQGTGSKVFPMSHQGTENIVAVMISNLKGMEILHSIQKGVYVTVIIEVG
RMHMQWVSHYIMYLFTFLAATIAYFYLDCVWRLTPRVPNSFTRRRSQIKTDVKKAIDQLQ
LRVLKEGDEELDLNEDNCVVCFDTYKPQDVVRILTCKHFFHKACIDPWLLAHRTCPMCKC
DILKT
Sequence length 305
Interactions View interactions

No strongly related genes found yet for RNF148.

No additional diseases found yet through genes similar to RNF148.