RNF133 (ring finger protein 133)

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 168433
Gene name Ring finger protein 133
Gene symbol RNF133
Synonyms (NCBI Gene)
-
Chromosome 7
Chromosome location 7q31.32
Summary The protein encoded by this gene contains a RING finger domain, a motif present in a variety of functionally distinct proteins and known to be involved in protein-protein and protein-DNA interactions. This gene has no intron. [provided by RefSeq, Jul 2008
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
16 Show/Hide all (16)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005737 Component Cytoplasm IBA
GO:0005770 Component Late endosome IBA
GO:0005783 Component Endoplasmic reticulum IBA
GO:0005783 Component Endoplasmic reticulum IEA
GO:0005789 Component Endoplasmic reticulum membrane IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
620556 21154 ENSG00000188050
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8WVZ7
Protein name E3 ubiquitin-protein ligase RNF133 (EC 2.3.2.27) (RING finger protein 133) (RING-type E3 ubiquitin transferase RNF133)
Protein function Has E3 ubiquitin-protein ligase activity (By similarity). Plays a role in male fecundity through the interaction with the E2 ubituitin-protein ligase UBE2J1 (PubMed:35831855).
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02225 PA 71 → 163 PA domain Family
PF13639 zf-RING_2 254 → 297 Ring finger domain Domain
Tissue specificity TISSUE SPECIFICITY: Expression is testis-specific. {ECO:0000269|PubMed:35831855}.
Sequence 
MHLLKVGTWRNNTASSWLMKFSVLWLVSQNCCRASVVWMAYMNISFHVGNHVLSELGETG
VFGRSSTLKRVAGVIVPPEGKIQNACNPNTIFSRSKYSETWLALIERGGCTFTQKIKVAT
EKGASGVIIYNVPGTGNQVFPMFHQAFEDVVVVMIGNLKGTEIFHLIKKGVLITAVVEVG
RKHIIWMNHYLVSFVIVTTATLAYFIFYHIHRLCLARIQNRRWQRLTTDLQNTFGQLQLR
VVKEGDEEINPNGDSCVICFERYKPNDIVRILTCKHFFHKNCIDPWILPHGTCPICKCDI
LKVLGIQVVVENGTEPLQVLMSNELPETLSPSEEETNNEVSPAGTSDKVIHVEENPTSQN
NDIQPHSVVEDVHPSP
Sequence length 376
Interactions View interactions

No strongly related genes found yet for RNF133.

No additional diseases found yet through genes similar to RNF133.