RNF112 (ring finger protein 112)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Related genes Diseases linked via similar genes

Gene

• Entrez ID: 7732
• Gene name: Ring finger protein 112
• Gene symbol: RNF112
• Synonyms (NCBI Gene): BFP, ZNF179
• Chromosome: 17
• Chromosome location: 17p11.2
• Summary: This gene encodes a member of the RING finger protein family of transcription factors. The protein is primarily expressed in brain. The gene is located within the Smith-Magenis syndrome region on chromosome 17. [provided by RefSeq, Jul 2008]

miRNA Show/Hide all (20)

miRTarBase ID	miRNA	Experiments	Reference
MIRT1309343	hsa-miR-1287	CLIP-seq
MIRT1309344	hsa-miR-3122	CLIP-seq
MIRT1309345	hsa-miR-3135b	CLIP-seq
MIRT1309346	hsa-miR-370	CLIP-seq
MIRT1309347	hsa-miR-3913-5p	CLIP-seq
MIRT1309348	hsa-miR-4468	CLIP-seq
MIRT1309349	hsa-miR-4540	CLIP-seq
MIRT1309350	hsa-miR-542-5p	CLIP-seq
MIRT1553132	hsa-miR-1292	CLIP-seq
MIRT1553133	hsa-miR-3202	CLIP-seq
MIRT1553134	hsa-miR-4471	CLIP-seq
MIRT1553135	hsa-miR-4747-5p	CLIP-seq
MIRT2091860	hsa-miR-4640-5p	CLIP-seq
MIRT2091861	hsa-miR-4711-5p	CLIP-seq
MIRT2091862	hsa-miR-4726-5p	CLIP-seq
MIRT2316342	hsa-miR-1206	CLIP-seq
MIRT2316343	hsa-miR-1915	CLIP-seq
MIRT2316344	hsa-miR-382	CLIP-seq
MIRT2316345	hsa-miR-4726-3p	CLIP-seq
MIRT2316346	hsa-miR-579	CLIP-seq

Gene ontology (GO) Show/Hide all (52)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0003924	Function	GTPase activity	IBA
GO:0003924	Function	GTPase activity	IEA
GO:0003924	Function	GTPase activity	ISS
GO:0005515	Function	Protein binding	IPI	32814053
GO:0005525	Function	GTP binding	IBA
GO:0005525	Function	GTP binding	IEA
GO:0005525	Function	GTP binding	ISS
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0005654	Component	Nucleoplasm	IEA
GO:0005654	Component	Nucleoplasm	ISS
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS
GO:0005768	Component	Endosome	IEA
GO:0005768	Component	Endosome	ISS
GO:0007029	Process	Endoplasmic reticulum organization	IBA
GO:0007399	Process	Nervous system development	IEA
GO:0008021	Component	Synaptic vesicle	IEA
GO:0008021	Component	Synaptic vesicle	ISS
GO:0008270	Function	Zinc ion binding	IEA
GO:0008270	Function	Zinc ion binding	NAS	8660987
GO:0014069	Component	Postsynaptic density	IEA
GO:0014069	Component	Postsynaptic density	ISS
GO:0016020	Component	Membrane	IEA
GO:0016567	Process	Protein ubiquitination	IEA
GO:0016604	Component	Nuclear body	IEA
GO:0016604	Component	Nuclear body	ISS
GO:0016740	Function	Transferase activity	IEA
GO:0030182	Process	Neuron differentiation	IDA	28684796
GO:0030182	Process	Neuron differentiation	IEA
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0033194	Process	Response to hydroperoxide	IEA
GO:0033194	Process	Response to hydroperoxide	ISS
GO:0042995	Component	Cell projection	IEA
GO:0043005	Component	Neuron projection	IEA
GO:0043204	Component	Perikaryon	IEA
GO:0044297	Component	Cell body	IEA
GO:0044297	Component	Cell body	ISS
GO:0045202	Component	Synapse	IEA
GO:0045666	Process	Positive regulation of neuron differentiation	IEA
GO:0045687	Process	Positive regulation of glial cell differentiation	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0051260	Process	Protein homooligomerization	IBA
GO:0051726	Process	Regulation of cell cycle	IDA	28684796
GO:0051865	Process	Protein autoubiquitination	IEA
GO:0051865	Process	Protein autoubiquitination	ISS
GO:0061630	Function	Ubiquitin protein ligase activity	IEA
GO:0061630	Function	Ubiquitin protein ligase activity	ISS
GO:0070315	Process	G1 to G0 transition involved in cell differentiation	IEA
GO:1990403	Process	Embryonic brain development	IEA
GO:1990403	Process	Embryonic brain development	ISS

Other IDs

• MIM: 601237
• HGNC: 12968
• e!Ensembl: ENSG00000128482

Protein

• UniProt ID: Q9ULX5
• Protein name: RING finger protein 112 (EC 2.3.2.27) (Brain finger protein) (Zinc finger protein 179)
• Protein function: E3 ubiquitin-protein ligase that plays an important role in neuronal differentiation, including neurogenesis and gliogenesis, during brain development. During embryonic development initiates neuronal differentiation by inducing cell cycle arrest
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00097	zf-C3HC4	57 → 97	Zinc finger, C3HC4 type (RING finger)	Domain
  PF02263	GBP	148 → 400	Guanylate-binding protein, N-terminal domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Predominantly expressed in brain (PubMed:10574464). Decreased expression in glioma brain tumors as compared to normal brains (at protein level) (PubMed:28684796). {ECO:0000269|PubMed:10574464, ECO:0000269|PubMed:28684796}.
• Sequence:

  MPRPALSVTSFCHRLGKRERKQSFMGNSGNSWSHTPFPKLELGLGPQPMAPRELPTCSIC
  LERLRDPISLDCGHDFCIRCFSTHRLPGCEPPCCPECRKICKQKRGLRSLGEKMKLLPQR
  PLPPALQETCPVRAEPLLLVRINASGGLILRMGAINRCLKHPLARDTPVCLLAVLGEQHS
  GKSFLLNHLLQGLPGLESGEGGRPRGGEASLQGCRWGANGLARGIWMWSHPFLLGKEGKK
  VAVFLVDTGDAMSPELSRETRIKLCALTTMLSSYQILSTSQELKDTDLDYLEMFVHVAEV
  MGKHYGMVPIQHLDLLVRDSSHPNKAGQGHVGNIFQRLSGRYPKVQELLQGKRARCCLLP
  APGRRRMNQGHASPGDTDDDFRHLLGAYVSDVLSAAPQHAKSRCQGYWNEGRAVARGDRR
  LLTGQQLAQEIKNLSGWMGRTGPGFTSPDEMAAQLHDLRKVEAAKREFEEYVRQQDVATK
  RIFSALRVLPDTMRNLLSTQKDAILARHGVALLCKGRDQTLEALEAELQATAKAFMDSYT
  MRFCGHLAAVGGAVGAGLMGLAGGVVGAGMAAAALAAEAGMVAAGAAVGATGAAVVGGGV
  GAGLAATVGCMEKEEDERLLEGDREPLLQEE

• Sequence length: 631

Related Genes

No strongly related genes found yet for RNF112.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to RNF112.