Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	122665
Gene name	Ribonuclease A family member 8
Gene symbol	RNASE8
Synonyms (NCBI Gene)	RAE2
Chromosome	14
Chromosome location	14q11.2
Summary	The protein encoded by this gene belongs to the pancreatic ribonuclease family, a subset of the ribonuclease A superfamily. The protein is expressed prominently in the placenta and exhibits antimicrobial activity against pathogenic bacteria and fungi. [pr

17 Show/Hide all (17)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003676	Function	Nucleic acid binding	IEA
GO:0004518	Function	Nuclease activity	IEA
GO:0004519	Function	Endonuclease activity	IEA
GO:0004522	Function	Ribonuclease A activity	IDA	11861908
GO:0004540	Function	RNA nuclease activity	IBA
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IBA
GO:0016787	Function	Hydrolase activity	IEA
GO:0045087	Process	Innate immune response	IBA
GO:0045087	Process	Innate immune response	IMP	16940129
GO:0050829	Process	Defense response to Gram-negative bacterium	IBA
GO:0050829	Process	Defense response to Gram-negative bacterium	IDA	16940129
GO:0050829	Process	Defense response to Gram-negative bacterium	IMP	16940129
GO:0050830	Process	Defense response to Gram-positive bacterium	IBA
GO:0050830	Process	Defense response to Gram-positive bacterium	IDA	16940129
GO:0050832	Process	Defense response to fungus	IBA
GO:0061760	Process	Antifungal innate immune response	IDA	16940129

MIM	HGNC	e!Ensembl
612485	19277	ENSG00000173431

Q8TDE3

Protein name

Ribonuclease 8 (RNase 8) (EC 3.1.27.-)

Protein function

Has a low ribonuclease activity.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00074	RnaseA	33 → 151	Pancreatic ribonuclease	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed prominently in the placenta and is not detected in any other tissues examined.

Sequence

MAPARAGCCPLLLLLLGLWVAEVLVRAKPKDMTSSQWFKTQHVQPSPQACNSAMSIINKY
TERCKDLNTFLHEPFSSVAITCQTPNIACKNSCKNCHQSHGPMSLTMGELTSGKYPNCRY
KEKHLNTPYIVACDPPQQGDPGYPLVPVHLDKVV

Sequence length

154

Interactions

View interactions

Reactome Pathway
Antimicrobial peptides

Related Genes Genes most often co-reported with RNASE8 across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for RNASE8.

Diseases Linked via Similar Genes Diseases curated for genes most similar to RNASE8 (see Related Genes above), that are NOT already directly curated for RNASE8 itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to RNASE8.

RNASE8 (ribonuclease A family member 8)

Bookmark This Gene