RNASE7 (ribonuclease A family member 7)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Related genes Diseases linked via similar genes

Gene

• Entrez ID: 84659
• Gene name: Ribonuclease A family member 7
• Gene symbol: RNASE7
• Synonyms (NCBI Gene): RAE1
• Chromosome: 14
• Chromosome location: 14q11.2
• Summary: The protein encoded by this gene belongs to the pancreatic ribonuclease family, a subset of the ribonuclease A superfamily. The protein has broad-spectrum antimicrobial activity against bacteria and fungi. [provided by RefSeq, Oct 2014]

miRNA Show/Hide all (50)

miRTarBase ID	miRNA	Experiments	Reference
MIRT1308638	hsa-miR-1207-5p	CLIP-seq
MIRT1308639	hsa-miR-1909	CLIP-seq
MIRT1308640	hsa-miR-19a	CLIP-seq
MIRT1308641	hsa-miR-19b	CLIP-seq
MIRT1308642	hsa-miR-2110	CLIP-seq
MIRT1308643	hsa-miR-3175	CLIP-seq
MIRT1308644	hsa-miR-3657	CLIP-seq
MIRT1308645	hsa-miR-4271	CLIP-seq
MIRT1308646	hsa-miR-4487	CLIP-seq
MIRT1308647	hsa-miR-4667-5p	CLIP-seq
MIRT1308648	hsa-miR-4669	CLIP-seq
MIRT1308649	hsa-miR-4700-5p	CLIP-seq
MIRT1308650	hsa-miR-4719	CLIP-seq
MIRT1308651	hsa-miR-4725-3p	CLIP-seq
MIRT1308652	hsa-miR-4731-5p	CLIP-seq
MIRT1308653	hsa-miR-4760-3p	CLIP-seq
MIRT1308654	hsa-miR-4763-3p	CLIP-seq
MIRT1308655	hsa-miR-605	CLIP-seq
MIRT1308656	hsa-miR-7	CLIP-seq
MIRT1308639	hsa-miR-1909	CLIP-seq
MIRT1308640	hsa-miR-19a	CLIP-seq
MIRT1308641	hsa-miR-19b	CLIP-seq
MIRT1308642	hsa-miR-2110	CLIP-seq
MIRT2091583	hsa-miR-3065-5p	CLIP-seq
MIRT2091584	hsa-miR-3120-3p	CLIP-seq
MIRT2091585	hsa-miR-3153	CLIP-seq
MIRT1308643	hsa-miR-3175	CLIP-seq
MIRT2091586	hsa-miR-3192	CLIP-seq
MIRT1308645	hsa-miR-4271	CLIP-seq
MIRT2091587	hsa-miR-4314	CLIP-seq
MIRT1308646	hsa-miR-4487	CLIP-seq
MIRT2091588	hsa-miR-4646-5p	CLIP-seq
MIRT1308647	hsa-miR-4667-5p	CLIP-seq
MIRT2091589	hsa-miR-4668-5p	CLIP-seq
MIRT1308649	hsa-miR-4700-5p	CLIP-seq
MIRT1308651	hsa-miR-4725-3p	CLIP-seq
MIRT1308652	hsa-miR-4731-5p	CLIP-seq
MIRT2091590	hsa-miR-570	CLIP-seq
MIRT1308656	hsa-miR-7	CLIP-seq
MIRT1308639	hsa-miR-1909	CLIP-seq
MIRT1308640	hsa-miR-19a	CLIP-seq
MIRT1308641	hsa-miR-19b	CLIP-seq
MIRT1308643	hsa-miR-3175	CLIP-seq
MIRT1308639	hsa-miR-1909	CLIP-seq
MIRT1308640	hsa-miR-19a	CLIP-seq
MIRT1308641	hsa-miR-19b	CLIP-seq
MIRT1308643	hsa-miR-3175	CLIP-seq
MIRT1308644	hsa-miR-3657	CLIP-seq
MIRT1308648	hsa-miR-4669	CLIP-seq
MIRT1308650	hsa-miR-4719	CLIP-seq

Gene ontology (GO) Show/Hide all (29)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001530	Function	Lipopolysaccharide binding	IDA	20180804
GO:0003676	Function	Nucleic acid binding	IEA
GO:0004518	Function	Nuclease activity	IEA
GO:0004519	Function	Endonuclease activity	IEA
GO:0004540	Function	RNA nuclease activity	IBA
GO:0004540	Function	RNA nuclease activity	IDA	12244054, 19641608
GO:0005515	Function	Protein binding	IPI	28514442, 33961781
GO:0005576	Component	Extracellular region	IDA	19641608, 23302724
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	NAS	12244054
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	25075772
GO:0005737	Component	Cytoplasm	IDA	25075772
GO:0016787	Function	Hydrolase activity	IEA
GO:0019731	Process	Antibacterial humoral response	IDA	25075772
GO:0042742	Process	Defense response to bacterium	IEA
GO:0042834	Function	Peptidoglycan binding	IDA	20180804
GO:0045087	Process	Innate immune response	IBA
GO:0045087	Process	Innate immune response	IDA	16940129, 25075772
GO:0045087	Process	Innate immune response	NAS	12244054
GO:0050829	Process	Defense response to Gram-negative bacterium	IBA
GO:0050829	Process	Defense response to Gram-negative bacterium	IDA	12244054, 16940129, 20180804, 25075772
GO:0050830	Process	Defense response to Gram-positive bacterium	IBA
GO:0050830	Process	Defense response to Gram-positive bacterium	IDA	12244054, 16940129, 19641608, 20180804, 25075772
GO:0050832	Process	Defense response to fungus	IBA
GO:0050832	Process	Defense response to fungus	IDA	12244054
GO:0051715	Process	Cytolysis in another organism	IDA	20180804
GO:0061844	Process	Antimicrobial humoral immune response mediated by antimicrobial peptide	IDA	12244054, 23302724, 25075772

Other IDs

• MIM: 612484
• HGNC: 19278
• e!Ensembl: ENSG00000165799

Protein

• UniProt ID: Q9H1E1
• Protein name: Ribonuclease 7 (RNase 7) (EC 3.1.27.-) (Skin-derived antimicrobial protein 2) (SAP-2)
• Protein function: Exhibits a potent RNase activity (PubMed:12244054, PubMed:12527768, PubMed:17150966). Has broad-spectrum antimicrobial activity against many pathogenic microorganisms including uropathogenic E.coli (UPEC), and remarkably potent activity (lethal
• PDB: 2HKY
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00074	RnaseA	34 → 153	Pancreatic ribonuclease	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in collecting ducts in kidney, and in apical uroepithelium in bladder (at protein level) (PubMed:25075772). Expressed in various epithelial tissues including skin, respiratory tract, genito-urinary tract and, at a low level,
• Sequence:

  MAPARAGFCPLLLLLLLGLWVAEIPVSAKPKGMTSSQWFKIQHMQPSPQACNSAMKNINK
  HTKRCKDLNTFLHEPFSSVAATCQTPKIACKNGDKNCHQSHGAVSLTMCKLTSGKHPNCR
  YKEKRQNKSYVVACKPPQKKDSQQFHLVPVHLDRVL

• Sequence length: 156

Pathways

Reactome Pathway:

Antimicrobial peptides

Related Genes

No strongly related genes found yet for RNASE7.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to RNASE7.