RNASE2 (ribonuclease A family member 2)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Diseases linked via similar genes

Gene

• Entrez ID: 6036
• Gene name: Ribonuclease A family member 2
• Gene symbol: RNASE2
• Synonyms (NCBI Gene): EDN, RAF3, RNS2
• Chromosome: 14
• Chromosome location: 14q11.2
• Summary: The protein encoded by this gene is a non-secretory ribonuclease that belongs to the pancreatic ribonuclease family, a subset of the ribonuclease A superfamily. The protein antimicrobial activity against viruses. [provided by RefSeq, Oct 2014]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT018080	hsa-miR-335-5p	Microarray	18185580

Transcription factors

Transcription factor	Regulation	Reference
HNF4A	Activation	19115260
SPI1	Activation	9490699

Gene ontology (GO) Show/Hide all (25)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001530	Function	Lipopolysaccharide binding	IMP	23992292
GO:0002227	Process	Innate immune response in mucosa	IBA
GO:0003676	Function	Nucleic acid binding	IEA
GO:0004518	Function	Nuclease activity	IEA
GO:0004519	Function	Endonuclease activity	IEA
GO:0004522	Function	Ribonuclease A activity	IEA
GO:0004540	Function	RNA nuclease activity	IDA	9826755
GO:0004540	Function	RNA nuclease activity	TAS	2734298
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005576	Component	Extracellular region	TAS	2734298
GO:0005615	Component	Extracellular space	IBA
GO:0005764	Component	Lysosome	IEA
GO:0006401	Process	RNA catabolic process	TAS	2734298
GO:0006935	Process	Chemotaxis	IBA
GO:0006935	Process	Chemotaxis	IDA	12855582
GO:0006935	Process	Chemotaxis	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0016829	Function	Lyase activity	IEA
GO:0035578	Component	Azurophil granule lumen	TAS
GO:0043152	Process	Induction of bacterial agglutination	IMP	23992292
GO:0050829	Process	Defense response to Gram-negative bacterium	IMP	23992292
GO:0050830	Process	Defense response to Gram-positive bacterium	IMP	23992292
GO:0051607	Process	Defense response to virus	IDA	9826755
GO:0051607	Process	Defense response to virus	IEA
GO:0070062	Component	Extracellular exosome	HDA	23533145

Other IDs

• MIM: 131410
• HGNC: 10045
• e!Ensembl: ENSG00000169385

Protein

• UniProt ID: P10153
• Protein name: Non-secretory ribonuclease (EC 4.6.1.18) (Eosinophil-derived neurotoxin) (RNase UpI-2) (Ribonuclease 2) (RNase 2) (Ribonuclease US)
• Protein function: This is a non-secretory ribonuclease. It is a pyrimidine specific nuclease with a slight preference for U. Cytotoxin and helminthotoxin. Selectively chemotactic for dendritic cells. Possesses a wide variety of biological activities. {ECO:0000269
• PDB: 1GQV , 1HI2 , 1HI3 , 1HI4 , 1HI5 , 1K2A , 2BEX , 2BZZ , 2C01 , 2C02 , 2C05 , 5E13 , 6SSO , 8F5X , 8QEW
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00074	RnaseA	33 → 158	Pancreatic ribonuclease	Domain

• Tissue specificity: TISSUE SPECIFICITY: Liver, lung, spleen, leukocytes and body fluids.
• Sequence:

  MVPKLFTSQICLLLLLGLLAVEGSLHVKPPQFTWAQWFETQHINMTSQQCTNAMQVINNY
  QRRCKNQNTFLLTTFANVVNVCGNPNMTCPSNKTRKNCHHSGSQVPLIHCNLTTPSPQNI
  SNCRYAQTPANMFYIVACDNRDQRRDPPQYPVVPVHLDRII

• Sequence length: 161

Pathways

Reactome Pathway:

Neutrophil degranulation

Related Genes

No strongly related genes found yet for RNASE2.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to RNASE2.