RNASE12 (ribonuclease A family member 12 (inactive))

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 493901
Gene name Ribonuclease A family member 12 (inactive)
Gene symbol RNASE12
Synonyms (NCBI Gene)
HEL-S-85pRAI1
Chromosome 14
Chromosome location 14q11.2
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
5
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0003676 Function Nucleic acid binding IEA
GO:0004540 Function RNA nuclease activity IBA
GO:0004540 Function RNA nuclease activity IKR 15676279
GO:0005576 Component Extracellular region IEA
GO:0050830 Process Defense response to Gram-positive bacterium IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q5GAN4
Protein name Probable inactive ribonuclease-like protein 12
Protein function Does not exhibit any ribonuclease activity.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00074 RnaseA 23 → 143 Pancreatic ribonuclease Domain
Sequence 
MIIMVIIFLVLLFWENEVNDEAVMSTLEHLHVDYPQNDVPVPARYCNHMIIQRVIREPDH
TCKKEHVFIHERPRKINGICISPKKVACQNLSAIFCFQSETKFKMTVCQLIEGTRYPACR
YHYSPTEGFVLVTCDDLRPDSFLGYVK
Sequence length 147
Interactions View interactions

No strongly related genes found yet for RNASE12.

No additional diseases found yet through genes similar to RNASE12.