RMDN3 (regulator of microtubule dynamics 3)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Related genes Diseases linked via similar genes

Gene

• Entrez ID: 55177
• Gene name: Regulator of microtubule dynamics 3
• Gene symbol: RMDN3
• Synonyms (NCBI Gene): FAM82A2, FAM82C, RMD-3, RMD3, ptpip51
• Chromosome: 15
• Chromosome location: 15q15.1

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT019889	hsa-miR-375	Microarray	20215506
MIRT028031	hsa-miR-93-5p	Sequencing	20371350
MIRT041538	hsa-miR-193b-3p	CLASH	23622248
MIRT037970	hsa-miR-505-5p	CLASH	23622248

Gene ontology (GO) Show/Hide all (29)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000922	Component	Spindle pole	IEA
GO:0005515	Function	Protein binding	IPI	18771726, 21900206, 21972092, 22131369, 26496610, 28514442, 29858488, 32296183, 33124732, 33961781, 35271311
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IBA
GO:0005739	Component	Mitochondrion	IDA	29858488
GO:0005739	Component	Mitochondrion	IEA
GO:0005741	Component	Mitochondrial outer membrane	IDA	22131369
GO:0005741	Component	Mitochondrial outer membrane	IEA
GO:0005819	Component	Spindle	IEA
GO:0005856	Component	Cytoskeleton	IEA
GO:0005874	Component	Microtubule	IEA
GO:0005876	Component	Spindle microtubule	IBA
GO:0005876	Component	Spindle microtubule	IDA	18070910
GO:0006874	Process	Intracellular calcium ion homeostasis	IMP	22131369
GO:0006915	Process	Apoptotic process	IEA
GO:0008017	Function	Microtubule binding	IBA
GO:0008017	Function	Microtubule binding	IDA	18070910
GO:0016020	Component	Membrane	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0044232	Component	Organelle membrane contact site	IDA	29858488
GO:0045171	Component	Intercellular bridge	IDA
GO:0097431	Component	Mitotic spindle pole	IBA
GO:0097431	Component	Mitotic spindle pole	IDA	18070910
GO:0098793	Component	Presynapse	IEA
GO:0098794	Component	Postsynapse	IEA
GO:0098978	Component	Glutamatergic synapse	IEA

Other IDs

• MIM: 611873
• HGNC: 25550
• e!Ensembl: ENSG00000137824

Protein

• UniProt ID: Q96TC7
• Protein name: Regulator of microtubule dynamics protein 3 (RMD-3) (hRMD-3) (Cerebral protein 10) (Protein FAM82A2) (Protein FAM82C) (Protein tyrosine phosphatase-interacting protein 51) (TCPTP-interacting protein 51)
• Protein function: Involved in cellular calcium homeostasis regulation. May participate in differentiation and apoptosis of keratinocytes. Overexpression induces apoptosis.
• PDB: 7CC7
• Tissue specificity: TISSUE SPECIFICITY: Present at high level in epidermis and seminiferous epithelium: while basal cells in the epidermis and spermatogonia show no perceptible amount, keratinocytes of suprabasal layers and differentiating first-order spermatocytes up to spe
• Sequence:

  MSRLGALGGARAGLGLLLGTAAGLGFLCLLYSQRWKRTQRHGRSQSLPNSLDYTQTSDPG
  RHVMLLRAVPGGAGDASVLPSLPREGQEKVLDRLDFVLTSLVALRREVEELRSSLRGLAG
  EIVGEVRCHMEENQRVARRRRFPFVRERSDSTGSSSVYFTASSGATFTDAESEGGYTTAN
  AESDNERDSDKESEDGEDEVSCETVKMGRKDSLDLEEEAASGASSALEAGGSSGLEDVLP
  LLQQADELHRGDEQGKREGFQLLLNNKLVYGSRQDFLWRLARAYSDMCELTEEVSEKKSY
  ALDGKEEAEAALEKGDESADCHLWYAVLCGQLAEHESIQRRIQSGFSFKEHVDKAIALQP
  ENPMAHFLLGRWCYQVSHLSWLEKKTATALLESPLSATVEDALQSFLKAEELQPGFSKAG
  RVYISKCYRELGKNSEARWWMKLALELPDVTKEDLAIQKDLEELEVILRD

• Sequence length: 470

Related Genes

No strongly related genes found yet for RMDN3.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to RMDN3.